KEGG   Mycobacterium tuberculosis H37Rv: Rv1695Help
Entry
Rv1695            CDS       T00015                                 

Gene name
ppnK
Definition
(RefSeq) inorganic polyphosphate/ATP-NAD kinase
  KO
K00858  
NAD+ kinase [EC:2.7.1.23]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv1695 (ppnK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     Rv1695 (ppnK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1918746..1919669
Genome map
AA seq 307 aa AA seqDB search
MTAHRSVLLVVHTGRDEATETARRVEKVLGDNKIALRVLSAEAVDRGSLHLAPDDMRAMG
VEIEVVDADQHAADGCELVLVLGGDGTFLRAAELARNASIPVLGVNLGRIGFLAEAEAEA
IDAVLEHVVAQDYRVEDRLTLDVVVRQGGRIVNRGWALNEVSLEKGPRLGVLGVVVEIDG
RPVSAFGCDGVLVSTPTGSTAYAFSAGGPVLWPDLEAILVVPNNAHALFGRPMVTSPEAT
IAIEIEADGHDALVFCDGRREMLIPAGSRLEVTRCVTSVKWARLDSAPFTDRLVRKFRLP
VTGWRGK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcatcgcagtgttctgctggtcgtccacaccgggcgcgacgaagccaccgag
accgcacggcgcgtagaaaaagtattgggcgacaataaaattgcgcttcgcgtgctctcg
gccgaagcagtcgaccgagggtcgttgcatctggctcccgacgacatgcgggccatgggc
gtcgagatcgaggtggttgacgcggaccagcacgcagccgacggctgcgaactggtgctg
gttttgggcggcgatggcacctttttgcgggcagccgagctggcccgcaacgccagcatt
ccggtgttgggcgtcaatctgggccgcatcggctttttggccgaggccgaggcggaggca
atcgacgcggtgctcgagcatgttgtcgcacaggattaccgggtggaagaccgcttgact
ctggatgtcgtggtgcgccagggcgggcgcatcgtcaaccggggttgggcgctcaacgaa
gtcagtctggaaaagggcccgaggctcggcgtgcttggggtggtcgtggaaattgacggt
cggccggtgtcggcgtttggctgcgacggggtgttggtgtccacgccgaccggatcaacc
gcctatgcattctcggcgggaggcccggtgctgtggcccgacctcgaagcgatcctggtg
gtccccaacaacgctcacgcgctgtttggccggccgatggtcaccagccccgaagccacc
atcgccatcgaaatagaggccgacgggcatgacgccttggtgttctgcgacggtcgccgc
gaaatgctgataccggccggcagcagactcgaggtcacccgctgtgtcacgtccgtcaaa
tgggcacggctggacagtgcgccattcaccgaccggctggtgcgcaagttccggttgccg
gtgaccggttggcgcggaaagtag

DBGET integrated database retrieval system