KEGG   Mycobacterium tuberculosis H37Rv: Rv1699Help
Entry
Rv1699            CDS       T00015                                 

Gene name
pyrG
Definition
(RefSeq) CTP synthase
  KO
K01937  
CTP synthase [EC:6.3.4.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv1699 (pyrG)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     Rv1699 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
1923829..1925589
Genome map
AA seq 586 aa AA seqDB search
MRKHPQTATKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPYLNVDPGTMNP
FQHGEVFVTEDGAETDLDVGHYERFLDRNLPGSANVTTGQVYSTVIAKERRGEYLGDTVQ
VIPHITDEIKRRILAMAQPDADGNRPDVVITEIGGTVGDIESQPFLEAARQVRHYLGRED
VFFLHVSLVPYLAPSGELKTKPTQHSVAALRSIGITPDALILRCDRDVPEALKNKIALMC
DVDIDGVISTPDAPSIYDIPKVLHREELDAFVVRRLNLPFRDVDWTEWDDLLRRVHEPHE
TVRIALVGKYVELSDAYLSVAEALRAGGFKHRAKVEICWVASDGCETTSGAAAALGDVHG
VLIPGGFGIRGIEGKIGAIAYARARGLPVLGLCLGLQCIVIEAARSVGLTNANSAEFDPD
TPDPVIATMPDQEEIVAGEADLGGTMRLGSYPAVLEPDSVVAQAYQTTQVSERHRHRYEV
NNAYRDKIAESGLRFSGTSPDGHLVEFVEYPPDRHPFVVGTQAHPELKSRPTRPHPLFVA
FVGAAIDYKAGELLPVEIPEIPEHTPNGSSHRDGVGQPLPEPASRG
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaagcacccgcaaaccgctaccaagcacctcttcgtcagcggcggcgttgcttcc
tcgctcggcaagggactgaccgccagcagcctaggacaattgttgacggctcgtgggtta
cacgtcacgatgcaaaagctcgacccgtacctcaacgtcgacccgggtaccatgaacccg
ttccagcacggcgaggtcttcgtgaccgaggacggtgccgaaaccgatctcgacgtcggc
cactacgaacggttcctcgatcgcaatttgcccggctcagcgaatgtgactaccgggcag
gtgtattcaacggtgatcgcgaaggagcgccgcggcgaatacctgggcgacaccgtgcag
gtgatcccccatatcaccgacgagataaaacggcgcatcctggcgatggcccaaccggac
gccgacggtaaccgcccggacgtggtcatcaccgaaatcgggggcactgtcggcgatatc
gagtcacagcccttcctggaggcagcgcggcaagtccggcactatctcggccgggaggac
gtgttttttctgcacgtgtcgctggtgccctacctggcgccgtcgggtgagctcaaaacc
aagccaacacagcactcggtggccgcactgcgcagcattgggattaccccggacgcgttg
atcctgcgctgcgaccgcgacgttcccgaagcgctgaaaaacaagattgcgttgatgtgt
gacgtcgatatcgacggcgttatctccaccccggacgcgccctccatctacgacataccc
aaggtattgcaccgcgaggagctcgatgcgttcgtggtgcgccgactcaatctgccgttc
cgcgacgtcgattggaccgaatgggacgacctgctgcgccgggttcacgaaccacatgag
acagtgcgaattgctttggtgggcaagtacgtcgaattatccgacgcttacctctcggtt
gccgaggcattgcgtgccggcggattcaagcaccgggccaaggtcgagatctgttgggtg
gcatccgacggttgtgaaacgaccagtggtgccgcggcggcgctcggcgatgtgcatggg
gtgctcattccgggcggattcggcatcaggggcatcgagggcaagatcggtgccattgca
tacgcgcgggcgcgcgggttgccggtgttggggctgtgcctcggtttgcagtgcattgtg
atcgaggccgcgcgatcggtcggtctcaccaacgccaattcggccgaatttgatcccgac
acaccagatcccgttatcgccacgatgcccgatcaagaagaaatcgtggccggcgaggcg
gatctgggcggtaccatgcgtctcgggtcctaccccgccgtgttggagccggattcggtt
gttgcccaggcataccaaactacccaggtgtccgagcggcatcgccaccggtacgaggtc
aacaacgcgtaccgagacaagatcgccgaaagcggcctgaggttttccgggacgtcacct
gacggacacttggtagagttcgtcgagtatccgccggatcggcatccgttcgttgtcggc
acccaggcccaccccgagttgaagagccgacccacccggccgcacccactgtttgtcgca
ttcgtcggggcagccatcgattacaaggcgggtgagttgctgcctgtcgagatccccgag
atccccgagcacacacccaacggtagctcccatcgggacggcgtgggccagccgctaccg
gaacctgcgtctcgtggctga

DBGET integrated database retrieval system