KEGG   Mycobacterium tuberculosis H37Rv: Rv1737cHelp
Entry
Rv1737c           CDS       T00015                                 

Gene name
narK2
Definition
(RefSeq) nitrate/nitrite transporter
  KO
K02575  
MFS transporter, NNP family, nitrate/nitrite transporter
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rv1737c (narK2)
Transporters [BR:mtu02000]
 Major Facilitator Superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    Rv1737c (narK2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(1964183..1965370)
Genome map
AA seq 395 aa AA seqDB search
MRGQAANLVLATWISVVNFWAWNLIGPLSTSYARDMSLSSAEASLLVATPILVGALGRIV
TGPLTDRFGGRAMLIAVTLASILPVLAVGVAATMGSYALLVFFGLFLGVAGTIFAVGIPF
ANNWYQPARRGFSTGVFGMGMVGTALSAFFTPRFVRWFGLFTTHAIVAAALASTAVVAMV
VLRDAPYFRPNADPVLPRLKAAARLPVTWEMSFLYAIVFGGFVAFSNYLPTYITTIYGFS
TVDAGARTAGFALAAVLARPVGGWLSDRIAPRHVVLASLAGTALLAFAAALQPPPEVWSA
ATFITLAVCLGVGTGGVFAWVARRAPAASVGSVTGIVAAAGGLGGYFPPLVMGATYDPVD
NDYTVGLLLLVATALVACTYTALHAREPVSEEASR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagggcaagcggccaatctcgtgctggccacctggatctcggtggtcaacttctgg
gcgtggaacctgatcggcccgctgtcgaccagctacgcgcgtgacatgtcactgtccagc
gccgaggcgtcgctgctcgtcgccaccccgatcctggtgggtgcccttggccgcatcgtc
accgggccgctcaccgaccgcttcggcgggcgcgccatgctcatcgcggtgacgctggcg
tcgatcctcccggtgctcgcggtcggggtcgcggcaaccatgggctcctacgcgttgctg
gtgtttttcgggctcttcctgggcgttgccggcacgatcttcgccgtcggcatcccgttc
gccaacaactggtaccagccggcgcggcgcggtttctccaccggcgtgttcggtatgggc
atggtcggcaccgcgctctcggcgttcttcaccccgcggtttgtacggtggttcggcctg
ttcaccacccacgccatcgtcgcggccgcgctcgcgtcgaccgccgtggtggccatggtc
gtgcttcgtgatgcaccctactttcggcccaacgccgacccggtgctgcccaggctcaag
gccgcggcacggttgccggtgacctgggagatgtcgtttctgtacgcgatcgtgttcggc
gggttcgtggcgttcagcaactacctgcccacctacatcaccacgatctacgggttctcc
acggtcgacgcgggcgctcgcaccgccgggttcgccctggcggcggtgctggcccggccg
gtgggcgggtggctctccgaccggatcgcaccgaggcacgtggtgctggcctcgctcgcc
gggaccgcgctgctggcgttcgccgcggcgttgcagccgccgccggaggtgtggtcggcg
gccaccttcatcaccctggcggtctgcctcggcgtgggcaccggcggcgtgttcgcgtgg
gtggcccgccgcgccccggccgcatcggtcggctcggtcaccggaatcgtcgccgcggca
ggcggattgggcggttacttcccgccgctggtgatgggcgcgacctacgacccggtcgac
aacgactacacggtcgggttgctgctgctggtggcgaccgcgctggtcgcgtgtacctac
accgcgctgcacgcgcgggagccggtgagtgaggaggcgtccaggtga

DBGET integrated database retrieval system