KEGG   Mycobacterium tuberculosis H37Rv: Rv1811Help
Entry
Rv1811            CDS       T00015                                 

Gene name
mgtC
Definition
(RefSeq) Mg2+ transport P-type ATPase MgtC
  KO
K07507  
putative Mg2+ transporter-C (MgtC) family protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Transporters [BR:mtu02000]
 Other Transporters
  Others
   Rv1811 (mgtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2053443..2054147
Genome map
AA seq 234 aa AA seqDB search
MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSS
PTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGT
IVAVHLLGRPLGRLVDRDNAVEDEGLQPYQVRVICRPKAETYVRAHIVQRTSSNDITLRG
IRTGPAGDDNITLTAHLLMVGHTPAKLERLVAELSLQPGVYAVHWYAGEHAQAE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgactgtcgccgatttcgctctccggctggccgtcggagtgggttgcggg
gccattatcgggctcgagcgccagtggcgggcgcggatggctgggttgcgcaccaacgct
ctggtggcgaccggtgctaccttgttcgtgctgtacgcggtcgccaccgaggacagcagc
cccacccgagtggcgtcctacgtggtttctggaattggattcctgggcggcggggtcatc
ctgcgggaggggttcaacgtccgcggtctgaacacggctgccacgctttggtgctcggcc
gcggtcggagtgctggccgcctccgggcatctggtgttcaccctgattggcaccggaacc
atcgtcgctgtccatctcctggggcgcccacttggccggctggtcgaccgcgacaacgcc
gtcgaagacgaagggctgcagccctaccaggtacgggtgatttgtcggcccaaagcagag
acctatgtacgtgcccatatcgtgcagcgcaccagcagcaacgacatcacgctgcggggt
atacgcacggggccggccggagacgacaacatcacgttgacggcccacctattgatggtt
ggccataccccggccaagctagagcggttggtggcggaactgtcgctgcagccgggcgtt
tacgctgtgcactggtatgccggtgagcacgcgcaggccgaatga

DBGET integrated database retrieval system