KEGG   Mycobacterium tuberculosis H37Rv: Rv1822Help
Entry
Rv1822            CDS       T00015                                 

Gene name
pgsA2
Definition
(RefSeq) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K08744  
cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rv1822 (pgsA2)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Rv1822 (pgsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2069080..2069709
Genome map
AA seq 209 aa AA seqDB search
MEPVLTQNRVLTVPNMLSVIRLALIPAFVYVVLSAHANGWGVAILVFSGVSDWADGKIAR
LLNQSSRLGALLDPAVDRLYMVTVPIVFGLSGIVPWWFVLTLLTRDALLAGTLPLLWSRG
LSALPVTYVGKAATFGFMVGFPTILLGQCDPLWSHVLLACGWAFLIWGMYAYLWAFVLYA
VQMTMVVRQMPKLKGRAHRPAAQNAGERG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagccggtgctcacgcagaatcgggtgctgactgtccccaacatgttgagcgttatt
cgcctcgcgctcatcccagcattcgtctacgtcgtgctcagcgcgcacgccaatggctgg
ggggtagcgatcctggtgttcagtggcgtttcggactgggctgatggcaagattgcacgg
ctactaaaccagtcatcgcggctgggcgcgctgctggacccggccgttgatcgcctctac
atggtcactgttcctatcgtgtttggcctgagcggcatcgtgccgtggtggtttgtcctt
acgttgctgacccgcgatgcgctgctggctgggacgctgccgctgctatggagccgtgga
ctgtcagcgctaccggtgacctacgtcggtaaggcagcgactttcggcttcatggttggc
tttccgaccattctgttggggcaatgcgatccattgtggagccatgtgctgctggcctgt
ggttgggcattcttgatctggggtatgtatgcctacttgtgggccttcgtgctgtatgca
gtgcagatgacgatggtggtgcggcagatgcctaagctcaagggcagggctcatcggccg
gcggcccagaacgctggtgaacgtggctga

DBGET integrated database retrieval system