KEGG   Mycobacterium tuberculosis H37Rv: Rv1832Help
Entry
Rv1832            CDS       T00015                                 

Gene name
gcvB
Definition
(RefSeq) glycine dehydrogenase
  KO
K00281  
glycine dehydrogenase [EC:1.4.4.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv1832 (gcvB)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1832 (gcvB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1832 (gcvB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Rv1832 (gcvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
2075877..2078702
Genome map
AA seq 941 aa AA seqDB search
MSDHSTFADRHIGLDSQAVATMLAVIGVDSLDDLAVKAVPAGILDTLTDTGAAPGLDSLP
PAASEAEALAELRALADANTVAVSMIGQGYYDTHTPPVLLRNIIENPAWYTAYTPYQPEI
SQGRLEALLNFQTLVTDLTGLEIANASMLDEGTAAAEAMTLMHRAARGPVKRVVVDADVF
TQTAAVLATRAKPLGIEIVTADLRAGLPDGEFFGVIAQLPGASGRITDWSALVQQAHDRG
ALVAVGADLLALTLIAPPGEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHAKHARQLPGR
LVGVSVDSDGTPAYRLALQTREQHIRRDKATSNICTAQVLLAVLAAMYASYHGAGGLTAI
ARRVHAHAEAIAGALGDALVHDKYFDTVLARVPGRADEVLARAKANGINLWRVDADHVSV
ACDEATTDTHVAVVLDAFGVAAAAPAHTDIATRTSEFLTHPAFTQYRTETSMMRYLRALA
DKDIALDRSMIPLGSCTMKLNAAAEMESITWPEFGRQHPFAPASDTAGLRQLVADLQSWL
VLITGYDAVSLQPNAGSQGEYAGLLAIHEYHASRGEPHRDICLIPSSAHGTNAASAALAG
MRVVVVDCHDNGDVDLDDLRAKVGEHAERLSALMITYPSTHGVYEHDIAEICAAVHDAGG
QVYVDGANLNALVGLARPGKFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVRAHLAPFLPG
HPFAPELPKGYPVSSAPYGSASILPITWAYIRMMGAEGLRAASLTAITSANYIARRLDEY
YPVLYTGENGMVAHECILDLRGITKLTGITVDDVAKRLADYGFHAPTMSFPVAGTLMVEP
TESESLAEVDAFCEAMIGIRAEIDKVGAGEWPVDDNPLRGAPHTAQCLLASDWDHPYTRE
QAAYPLGTAFRPKVWPAVRRIDGAYGDRNLVCSCPPVEAFA
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaccattcgacgttcgcagaccggcacatcggtctggacagccaggccgtcgcg
accatgctcgccgtgatcggggtggattcgctcgatgacctggcagtcaaggcggtcccg
gcgggcatcctagacacactcaccgacaccggagccgcaccgggtttggacagtctgcca
ccggctgccagcgaagccgaggcgctggccgagctgcgagcgctggccgacgctaacacc
gtcgccgtgtcgatgatcgggcaaggctactacgacacacacacccccccggtgctgttg
cgcaacatcatcgagaacccggcctggtataccgcctacacgccgtaccagcccgagatt
agtcagggtcggctggaagccttgctgaacttccagaccctggtcaccgatctgaccggc
ctcgagatcgcgaacgcgtcgatgctcgacgagggcaccgcggcggccgaggccatgact
ttgatgcaccgcgcggcccgcgggccggtgaagagggtggtcgtggacgccgacgtgttc
acccagaccgcggcggtgctggccacccgcgccaagccgctgggtatcgagatcgtcacg
gccgacctgcgcgccggtctgcccgacggcgaatttttcggcgtcatcgcccagctgccc
ggggccagcggccggatcaccgactggtctgccctggtgcaacaggcccacgaccgtggc
gcactggtggccgtcggcgccgacttgttggcgctgacgctgatcgcgccgcccggagag
atcggcgctgacgtcgcctttggcaccacacaacggttcggagtgccgatggggtttggc
ggcccgcatgccgggtaccttgcggtgcacgccaagcatgcgcgtcagctgcccggccgg
ctggtcggtgtgtccgtcgacagtgacggcacgccggcctatcggttggcgctgcagact
cgcgagcaacacatccgccgcgacaaggccaccagcaacatctgcaccgcacaagtgctg
ttggcggtgcttgccgcgatgtacgcgagctaccacggcgcgggcgggctgaccgccatc
gcacgccgggtgcatgcccacgccgaggctatcgccggtgcactgggcgatgcgttggtg
cacgacaagtacttcgacacggtgttggcccgggtgcccggtcgtgccgacgaggtgctg
gccagggccaaggccaacggcatcaacctgtggcgtgtcgacgccgaccatgtgtcggta
gcctgcgacgaagccaccactgacacccacgtggcggtcgttctggacgcgttcggtgta
gcggccgccgcacccgcccatacggacatcgcaacgcgcacatcggagttcctgacgcat
ccagcgttcacgcaataccgcaccgagacgtcgatgatgcggtacttgcgtgcgctggcg
gataaggatattgccctcgaccgcagcatgattccgctcggctcgtgcacgatgaaactc
aacgccgccgccgagatggagtcgattacctggcctgaattcgggcgtcagcatccattt
gccccggcatctgataccgctgggctgcgtcaacttgttgccgacctacagagttggctg
gtgctgatcaccggttatgacgcggtgtcgctgcaacctaacgcgggctcgcaaggcgag
tatgcgggcctattggcgatccacgagtaccacgccagccggggtgaaccgcatcgcgac
atctgcctgatcccgtccagcgcgcacggcaccaatgccgcgtcagccgccttggccggc
atgcgcgtggtggtggtggactgccacgacaacggcgacgtcgacctcgatgacctgcgc
gctaaggtcggggagcatgccgagcggttgtcggcgctaatgatcacctacccgtccact
cacggcgtgtacgaacacgacatcgccgagatctgcgctgccgtgcacgacgcgggcggc
caggtatacgtcgacggagccaacctcaacgccctggtcggcctggcccggccgggcaag
ttcggcggtgacgtcagtcacctcaacctacacaagacattctgcattccgcacggcggc
ggtggcccaggcgtcggcccggtggcggtgcgggcgcacctggcaccgtttctgccaggt
caccccttcgcccccgagctgcccaagggctatccggtgtcgtcggcaccatatgggtcg
gcttcgattcttccgatcacctgggcatacatccggatgatgggggctgagggactgcgg
gcggcatcgctgacagcgatcacgtcggctaactacattgcgcgccgccttgacgagtat
tacccggtgctgtacaccggcgagaacggcatggtcgcccacgagtgcatcctggacttg
cgcggtatcactaagttgaccggtatcaccgtcgacgatgtcgcaaaacggctggcagac
tatggttttcacgcaccaacgatgagttttccggtggccggtacgctcatggtggagccc
accgagagcgagagcctggccgaagtggacgccttctgcgaggccatgatcggcatccgc
gccgagatcgacaaagtcggggccggggagtggcctgtcgacgacaatccgctgcgcggc
gcaccgcacaccgcgcagtgcctgctggcgtctgattgggaccacccgtatacgcgggaa
caggccgcctacccgctcggcaccgcattccgacccaaggtttggcccgcggtacgtcgc
atcgacggcgcctacggggatcgcaacctggtctgctcatgcccgccggtagaggctttt
gcctaa

DBGET integrated database retrieval system