KEGG   Mycobacterium tuberculosis H37Rv: Rv1832Help
Entry
Rv1832            CDS       T00015                                 

Gene name
gcvB
Definition
(RefSeq) glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1832 (gcvB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1832 (gcvB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     Rv1832 (gcvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 885716
NCBI-ProteinID: NP_216348
TubercuList: Rv1832
UniProt: P9WN53 I6X2F4
Position
2075877..2078702
Genome map
AA seq 941 aa AA seqDB search
MSDHSTFADRHIGLDSQAVATMLAVIGVDSLDDLAVKAVPAGILDTLTDTGAAPGLDSLP
PAASEAEALAELRALADANTVAVSMIGQGYYDTHTPPVLLRNIIENPAWYTAYTPYQPEI
SQGRLEALLNFQTLVTDLTGLEIANASMLDEGTAAAEAMTLMHRAARGPVKRVVVDADVF
TQTAAVLATRAKPLGIEIVTADLRAGLPDGEFFGVIAQLPGASGRITDWSALVQQAHDRG
ALVAVGADLLALTLIAPPGEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHAKHARQLPGR
LVGVSVDSDGTPAYRLALQTREQHIRRDKATSNICTAQVLLAVLAAMYASYHGAGGLTAI
ARRVHAHAEAIAGALGDALVHDKYFDTVLARVPGRADEVLARAKANGINLWRVDADHVSV
ACDEATTDTHVAVVLDAFGVAAAAPAHTDIATRTSEFLTHPAFTQYRTETSMMRYLRALA
DKDIALDRSMIPLGSCTMKLNAAAEMESITWPEFGRQHPFAPASDTAGLRQLVADLQSWL
VLITGYDAVSLQPNAGSQGEYAGLLAIHEYHASRGEPHRDICLIPSSAHGTNAASAALAG
MRVVVVDCHDNGDVDLDDLRAKVGEHAERLSALMITYPSTHGVYEHDIAEICAAVHDAGG
QVYVDGANLNALVGLARPGKFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVRAHLAPFLPG
HPFAPELPKGYPVSSAPYGSASILPITWAYIRMMGAEGLRAASLTAITSANYIARRLDEY
YPVLYTGENGMVAHECILDLRGITKLTGITVDDVAKRLADYGFHAPTMSFPVAGTLMVEP
TESESLAEVDAFCEAMIGIRAEIDKVGAGEWPVDDNPLRGAPHTAQCLLASDWDHPYTRE
QAAYPLGTAFRPKVWPAVRRIDGAYGDRNLVCSCPPVEAFA
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaccattcgacgttcgcagaccggcacatcggtctggacagccaggccgtcgcg
accatgctcgccgtgatcggggtggattcgctcgatgacctggcagtcaaggcggtcccg
gcgggcatcctagacacactcaccgacaccggagccgcaccgggtttggacagtctgcca
ccggctgccagcgaagccgaggcgctggccgagctgcgagcgctggccgacgctaacacc
gtcgccgtgtcgatgatcgggcaaggctactacgacacacacacccccccggtgctgttg
cgcaacatcatcgagaacccggcctggtataccgcctacacgccgtaccagcccgagatt
agtcagggtcggctggaagccttgctgaacttccagaccctggtcaccgatctgaccggc
ctcgagatcgcgaacgcgtcgatgctcgacgagggcaccgcggcggccgaggccatgact
ttgatgcaccgcgcggcccgcgggccggtgaagagggtggtcgtggacgccgacgtgttc
acccagaccgcggcggtgctggccacccgcgccaagccgctgggtatcgagatcgtcacg
gccgacctgcgcgccggtctgcccgacggcgaatttttcggcgtcatcgcccagctgccc
ggggccagcggccggatcaccgactggtctgccctggtgcaacaggcccacgaccgtggc
gcactggtggccgtcggcgccgacttgttggcgctgacgctgatcgcgccgcccggagag
atcggcgctgacgtcgcctttggcaccacacaacggttcggagtgccgatggggtttggc
ggcccgcatgccgggtaccttgcggtgcacgccaagcatgcgcgtcagctgcccggccgg
ctggtcggtgtgtccgtcgacagtgacggcacgccggcctatcggttggcgctgcagact
cgcgagcaacacatccgccgcgacaaggccaccagcaacatctgcaccgcacaagtgctg
ttggcggtgcttgccgcgatgtacgcgagctaccacggcgcgggcgggctgaccgccatc
gcacgccgggtgcatgcccacgccgaggctatcgccggtgcactgggcgatgcgttggtg
cacgacaagtacttcgacacggtgttggcccgggtgcccggtcgtgccgacgaggtgctg
gccagggccaaggccaacggcatcaacctgtggcgtgtcgacgccgaccatgtgtcggta
gcctgcgacgaagccaccactgacacccacgtggcggtcgttctggacgcgttcggtgta
gcggccgccgcacccgcccatacggacatcgcaacgcgcacatcggagttcctgacgcat
ccagcgttcacgcaataccgcaccgagacgtcgatgatgcggtacttgcgtgcgctggcg
gataaggatattgccctcgaccgcagcatgattccgctcggctcgtgcacgatgaaactc
aacgccgccgccgagatggagtcgattacctggcctgaattcgggcgtcagcatccattt
gccccggcatctgataccgctgggctgcgtcaacttgttgccgacctacagagttggctg
gtgctgatcaccggttatgacgcggtgtcgctgcaacctaacgcgggctcgcaaggcgag
tatgcgggcctattggcgatccacgagtaccacgccagccggggtgaaccgcatcgcgac
atctgcctgatcccgtccagcgcgcacggcaccaatgccgcgtcagccgccttggccggc
atgcgcgtggtggtggtggactgccacgacaacggcgacgtcgacctcgatgacctgcgc
gctaaggtcggggagcatgccgagcggttgtcggcgctaatgatcacctacccgtccact
cacggcgtgtacgaacacgacatcgccgagatctgcgctgccgtgcacgacgcgggcggc
caggtatacgtcgacggagccaacctcaacgccctggtcggcctggcccggccgggcaag
ttcggcggtgacgtcagtcacctcaacctacacaagacattctgcattccgcacggcggc
ggtggcccaggcgtcggcccggtggcggtgcgggcgcacctggcaccgtttctgccaggt
caccccttcgcccccgagctgcccaagggctatccggtgtcgtcggcaccatatgggtcg
gcttcgattcttccgatcacctgggcatacatccggatgatgggggctgagggactgcgg
gcggcatcgctgacagcgatcacgtcggctaactacattgcgcgccgccttgacgagtat
tacccggtgctgtacaccggcgagaacggcatggtcgcccacgagtgcatcctggacttg
cgcggtatcactaagttgaccggtatcaccgtcgacgatgtcgcaaaacggctggcagac
tatggttttcacgcaccaacgatgagttttccggtggccggtacgctcatggtggagccc
accgagagcgagagcctggccgaagtggacgccttctgcgaggccatgatcggcatccgc
gccgagatcgacaaagtcggggccggggagtggcctgtcgacgacaatccgctgcgcggc
gcaccgcacaccgcgcagtgcctgctggcgtctgattgggaccacccgtatacgcgggaa
caggccgcctacccgctcggcaccgcattccgacccaaggtttggcccgcggtacgtcgc
atcgacggcgcctacggggatcgcaacctggtctgctcatgcccgccggtagaggctttt
gcctaa

DBGET integrated database retrieval system