KEGG   Mycobacterium tuberculosis H37Rv: Rv1854cHelp
Entry
Rv1854c           CDS       T00015                                 

Gene name
ndh
Definition
(RefSeq) NADH dehydrogenase
  KO
K03885  
NADH dehydrogenase [EC:1.6.99.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Rv1854c (ndh)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     Rv1854c (ndh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2101651..2103042)
Genome map
AA seq 463 aa AA seqDB search
MSPQQEPTAQPPRRHRVVIIGSGFGGLNAAKKLKRADVDIKLIARTTHHLFQPLLYQVAT
GIISEGEIAPPTRVVLRKQRNVQVLLGNVTHIDLAGQCVVSELLGHTYQTPYDSLIVAAG
AGQSYFGNDHFAEFAPGMKSIDDALELRGRILSAFEQAERSSDPERRAKLLTFTVVGAGP
TGVEMAGQIAELAEHTLKGAFRHIDSTKARVILLDAAPAVLPPMGAKLGQRAAARLQKLG
VEIQLGAMVTDVDRNGITVKDSDGTVRRIESACKVWSAGVSASRLGRDLAEQSRVELDRA
GRVQVLPDLSIPGYPNVFVVGDMAAVEGVPGVAQGAIQGAKYVASTIKAELAGANPAERE
PFQYFDKGSMATVSRFSAVAKIGPVEFSGFIAWLIWLVLHLAYLIGFKTKITTLLSWTVT
FLSTRRGQLTITDQQAFARTRLEQLAELAAEAQGSAASAKVAS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagtccccagcaagaacccacagcgcaaccacctcgtaggcatcgagttgtgatcatc
ggatctgggttcggcgggctaaacgcggcaaagaagctcaagcgggccgacgttgacatc
aagctgatcgcgcgcaccacccatcacctgttccagccgctgctgtaccaagtggccacc
gggattatctccgagggagaaatcgctccgccgacccgggtcgtgctgcgtaagcagcgc
aatgtccaggtactgttgggcaacgtcacccacatcgacctggccgggcagtgcgtcgtc
tcggaattgctcggtcacacctaccaaaccccctacgacagcctgatcgtcgccgcgggt
gctggccagtcttatttcggcaacgaccatttcgccgaattcgcacccggcatgaagtcc
atcgacgacgcgttggagttgcgtggccgcatattgagcgctttcgagcaagccgaacgg
tccagcgatccggaacggcgggccaagctactgacattcaccgttgtcggggctggcccc
accggtgttgaaatggccggacagatcgccgagctggccgagcacacgttgaagggcgca
ttccggcacatcgactcgaccaaggcgcgggtgattctgcttgacgccgccccggcggtg
ctgccaccgatgggcgcaaagctcggtcagcgggcggctgcccggttgcagaagctgggc
gtggaaatccagctgggtgcgatggtcaccgacgtcgaccgcaacggcatcaccgtcaag
gactccgacggcaccgtccggcgcatcgagtcggcctgcaaggtctggtcggccggggtt
tcggccagtcggttgggcagggaccttgccgagcaatcacgggttgagctcgaccgggcc
ggccgggtccaagtgctgcccgacctgtccattcccgggtacccgaacgtgttcgtggtg
ggcgatatggccgctgtggagggtgtgccgggtgtggcgcagggcgccatccagggggcg
aaatacgtcgccagcacgatcaaggccgaactggccggcgccaacccggcggagcgtgag
ccattccagtacttcgacaagggatcgatggccacggtttcgaggttttcggcggtggcc
aagatcggtcccgttgagttcagcggctttatcgcctggctgatttggctggtgctgcac
ctggcgtacctgatcgggttcaagaccaagatcaccactctgctgtcgtggacggtgact
ttcctcagtactcgccgcggccagctgaccatcaccgaccagcaggcatttgcgcgaacg
cggctcgaacagctggccgagctggccgccgaggcgcagggctcagcggcaagcgctaag
gtggccagctag

DBGET integrated database retrieval system