KEGG   Mycobacterium tuberculosis H37Rv: Rv1872cHelp
Entry
Rv1872c           CDS       T00015                                 

Gene name
lldD2
Definition
(RefSeq) L-lactate dehydrogenase
  KO
K00101  
L-lactate dehydrogenase (cytochrome) [EC:1.1.2.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyruvate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv1872c (lldD2)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.2  With a cytochrome as acceptor
    1.1.2.3  L-lactate dehydrogenase (cytochrome)
     Rv1872c (lldD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2121907..2123151)
Genome map
AA seq 414 aa AA seqDB search
MAVNRRVPRVRDLAPLLQFNRPQFDTSKRRLGAALTIQDLRRIAKRRTPRAAFDYADGGA
EDELSIARARQGFRDIEFHPTILRDVTTVCAGWNVLGQPTVLPFGIAPTGFTRLMHTEGE
IAGARAAAAAGIPFSLSTLATCAIEDLVIAVPQGRKWFQLYMWRDRDRSMALVRRVAAAG
FDTMLVTVDVPVAGARLRDVRNGMSIPPALTLRTVLDAMGHPRWWFDLLTTEPLAFASLD
RWPGTVGEYLNTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSN
HGGRQLDRAPVPFHLLPHVARELGKHTEILVDTGIMSGADIVAAIALGARCTLIGRAYLY
GLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRHVTQLRRLGPIGAPT
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcaaccggcgagtgcccagagtgcgcgatctggcacccctgctccagttcaac
aggccgcagttcgacacctccaagcgccgcctgggcgccgcgctgaccatccaggacctg
cgacgcattgccaaacggcgtacccctagggcggcgttcgactacgccgacgggggtgcc
gaggacgaactgtccatcgcgcgtgctcgacaagggttccgcgacatcgagtttcacccg
acaatcctgcgtgacgtcaccaccgtgtgcgccggctggaacgtcctcggtcagcccacc
gtcttgccattcgggatcgcgccaaccgggttcacccgcttgatgcacaccgagggcgag
atcgccggcgcgcgggcggcggccgcggctgggatcccgttttcgctatccaccctggcc
acctgtgccatcgaagacctcgtcatcgctgtgccgcagggccgcaaatggttccagctg
tatatgtggcgtgatcgagaccgctcgatggcattggtgcggcgcgtcgccgccgcggga
tttgacaccatgctggtcacggtcgacgtcccggtcgccggtgcccggctacgcgatgtc
cgcaacgggatgtccatcccgccggcgctgacgctgcgaaccgttctcgacgcgatggga
cacccgcggtggtggttcgacttgttgaccaccgaaccgctggccttcgcttcactggat
cgctggcctggcaccgtcggcgagtacttgaacaccgtgttcgaccccagcctcaccttc
gacgatttggcctggatcaagtcgcagtggccgggcaagctcgttgtcaaagggatccaa
acactcgacgacgcccgcgccgtggtggaccgcggcgtcgacggcatcgtgttgtccaat
cacggcggccgccagcttgaccgagccccggtacccttccacctgttgccccacgtggca
cgcgaactgggcaaacacaccgaaatcctggtggacaccggcatcatgtcgggcgccgat
atcgtcgcggcgatcgcgttgggggcacggtgcacgctgatcgggcgggcctacctttac
gggctgatggccggtggtgaggcgggcgtcaaccgcgcgatcgagatccttcagacaggt
gtgatccggaccatgcggctactgggcgtgacctgccttgaggagctgtcacctcggcac
gtgacacaactgcggcggctcggccctatcggggcaccaacgtga

DBGET integrated database retrieval system