KEGG   Mycobacterium tuberculosis H37Rv: Rv2048cHelp
Entry
Rv2048c           CDS       T00015                                 

Gene name
pks12
Definition
(RefSeq) polyketide synthase
  KO
K12436  
polyketide synthase 12
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Modular PKS
   Rv2048c (pks12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2294531..2306986)
Genome map
AA seq 4151 aa AA seqDB search
MVDQLQHATEALRKALVQVERLKRTNRALLERSSEPIAIVGMSCRFPGGVDSPEGLWQMV
ADARDVMSEFPTDRGWDLAGLFDPDPDVRHKSYARTGGFVDGVADFDPAFFGISPSEALA
MDPQHRMLLELSWEALERAGIDPTGLRGSATGVFAGLIVGGYGMLAEEIEGYRLTGMTSS
VASGRVAYVLGLEGPAVSVDTACSSSLVALHMAVGSLRSGECDLALAGGVTVNATPTVFV
EFSRHRGLAPDGRCKPYAGRADGVGWSEGGGMLVLQRLSDARRLGHPVLAVVVGSAVNQD
GASNGLTAPNGPSQQRVVRAALANAGLSAAEVDVVEGHGTGTTLGDPIEAQALLATYGQD
RGEPGEPLWLGSVKSNMGHTQAAAGVAGVIKMVLAMRHELLPATLHVDVPSPHVDWSAGA
VELLTAPRVWPAGARTRRAGVSSFGISGTNAHVIIEAVPVVPRREAGWAGPVVPWVVSAK
SESALRGQAARLAAYVRGDDGLDVADVGWSLAGRSVFEHRAVVVGGDRDRLLAGLDELAG
DQLGGSVVRGTATAAGKTVFVFPGQGSQWLGMGIELLDTAPAFAQQIDACAEAFAEFVDW
SLVDVLRGAPGAPGLDRVDVVQPVLFAVMVSLAELWKSVAVHPDAVIGHSQGEIAAAYVA
GALSLRDAARVVTLRSKLLAGLAGPGGMVSIACGADQARDLLAPFGDRVSIAVVNGPSAV
VVSGEVGALEELIAVCSTKELRTRRIEVDYASHSVEVEAIRGPLAEALSGIEPRSTRTVF
FSTVTGNRLDTAGLDADYWYRNVRQTVLFDQAVRNACEQGYRTFIESSPHPALITGVEET
FAACTDGDSEAIVVPTLGRGDGGLHRFLLSAASAFVAGVAVNWRGTLDGAGYVELPTYAF
DKRRFWLSAEGSGADVSGLGLGASEHPLLGAVVDLPASGGVVLTGRLSPNVQPWLADHAV
SDVVLFPGTGFVELAIRAGDEVGCSVLDELTLAAPLLLPATGSVAVQVVVDAGRDSNSRG
VSIFSRADAQAGWLLHAEGILRPGSVEPGADLSVWPPAGAVTVDVADGYERLATRGYRYG
PAFRGLTAMWARGEEIFAEVRLPEAAGGVGGFGVHPALLDAVLHAVVIAGDPDELALPFA
WQGVSLHATGASAVRARIAPAGPSAVSVELADGLGLPVLSVASMVARPVTERQLLAAVSG
SGPDRLFEVIWSPASAATSPGPTPAYQIFESVAADQDPVAGSYVRSHQALAAVQSWLTDH
ESGVLVVATRGAMALPREDVADLAGAAVWGLVRSAQTEHPGRIVLVDSDAATDDAAIAMA
LATGEPQVVLRGGQVYTARVRGSRAADAILVPPGDGPWRLGLGSAGTFENLRLEPVPNAD
APLGPGQVRVAMRAIAANFRDIMITLGMFTHDALLGGEGAGVVVEVGPGVTEFSVGDSVF
GFFPDGSGTLVAGDVRLLLPMPADWSYAEAAAISAVFTTAYYAFIHLADVQPGQRVLIHA
GTGGVGMAAVQLARHLGLEVFATASKGKWDTLRAMGFDDDHISDSRSLEFEDKFRAATGG
RGFDVVLDSLAGEFVDASLRLVAPGGVFLEMGKTDIRDPGVIAQQYPGVRYRAFDLFEPG
RPRMHQYMLELATLFGDGVLRPLPVTTFDVRRAPAALRYLSQARHTGKVVMLMPGSWAAG
TVLITGGTGMAGSAVARHVVARHGVRNLVLVSRRGPDAPGAAELVAELAAAGAQVQVVAC
DAADRAALAKVIADIPVQHPLSGVIHTAGALDDAVVMSLTPDRVDVVLRSKVDAAWHLHE
LTRDLDVSAFVMFSSMAGLVGSSGQANYAAANSFLDALAAHRRAHGLPAISLGWGLWDQA
SAMTGGLDAADLARLGREGVLALSTAEALELFDTAMIVDEPFLAPARIDLTALRAHAVAV
PPMFSDLASAPTRRQVDDSVAAAKSKSALAHRLHGLPEAEQHAVLLGLVRLHIATVLGNI
TPEAIDPDKAFQDLGFDSLTAVEMRNRLKSATGLSLSPTLIFDYPTPNRLASYIRTELAG
LPQEIKHTPAVRTTSEDPIAIVGMACRYPGGVNSPDDMWDMLIQGRDVLSEFPADRGWDL
AGLYNPDPDAAGACYTRTGGFVDGVGDFDPAFFGVGPSEALAMDPQHRMLLELSWEALER
AGIDPTGLRGSATGVFAGVMTQGYGMFAAEPVEGFRLTGQLSSVASGRVAYVLGLEGPAV
SVDTACSSSLVALHMAVGSLRSGECDLALAGGVTVNATPDIFVEFSRWRGLSPDGRCKAF
AAAADGTGFSEGGGMLVLQRLSDARRLGHPVLAVVVGSAVNQDGASNGLTAPNGPSQQRV
VRAALANAGLSAAEVDVVEGHGTGTTLGDPIEAQALLATYGQDRGEPGEPLWLGSVKSNM
GHTQAAAGVAGVIKMVLAMRHELLPATLHVDVPSPHVDWSAGAVELLTAPRVWPAGARTR
RAGVSSFGISGTNAHVIIEAVPVVPRREAGWAGPVVPWVVSAKSESALRGQAARLAAYVR
GDDGLDVADVGWSLAGRSVFEHRAVVVGGDRDRLLAGLDELAGDQLGGSVVRGTATAAGK
TVFVFPGQGSQWLGMGMGLHAGYPVFAEAFNTVVGELDRHLLRPLREVMWGHDENLLNST
EFAQPALFAVEVALFRLLGSWGVRPDFVMGHSIGELSAAHVAGVLSLENAAVLVAARGRL
MQALPAGGAMVAVQAAEEEVRPLLSAEVDIAAVNGPASLVISGAQNAVAAVADQLRADGR
RVHQLAVSHAFHSPLMDPMIDEFAAVAAGIAIGRPTIGVISNVTGQLAGDDFGSAAYWRR
HIRQAVRFADSVRFAQAAGGSRFLEVGPSGGLVASIEESLPDVAVTTMSALRKDRPEPAT
LTNAVAQGFVTGMDLDWRAVVGEAQFVELPTYAFQRRRFWLSGDGVAADAAGLGLAASEH
ALLGAVIDLPASGGVVLTGRLSPSVQGWLADHSVAGVTIFPGAGFVELAIRAGDEVGCGV
VDELTLAAPLVLPASGSVAVQVVVNGPDESGVRGVSVYSRGDVGTGWVLHAEGALRAGSA
EPTADLAMWPPAGAVPVEVADGYQQLAERGYGYGPAFRGLTAMWRRGDEVFAEVALPADA
GVSVTGFGVHPVLLDAALHAVVLSAESAERGQGSVLVPFSWQGVSLHAAGASAVRARIAP
VGPSAVSIELADGLGLPVLSVASMLARPVTDQQLRAAVSSSGPDRLFEVTWSPQPSAAVE
PLPVCAWGTTEDSAAVVFESVPLAGDVVAGVYAATSSVLDVLQSWLTRDGAGVLVVMTRG
AVALPGEDVTDLAGAAVWGLVRSAQTEHPGRIVLVDSDAPLDDSALAAVVTTGEPQVLWR
RGEVYTARVHGSRAVGGLLVPPSDRPWRLAMSTAGTFENLRLELIPDADAPLGPGQVRVA
VSAIAANFRDVMIALGLYPDPDAVMGVEACGVVIETSLNKGSFAVGDRVMGLFPEGTGTV
ASTDQRLLVKVPAGWSHTAAATTSVVFATAHYALVDLAAARSGQRVLIHAGTGGVGMAAV
QLARHLGLEVFATASKGKWDTLRAMGFDDDHISDSRSLEFEDKFRAATGGRGFDVVLDSL
AGEFVDASLRLVAPGGVFLEMGKTDIRDPGVIAQQYPGVRYRAFDLFEPGPDRIAQILAE
LATLFGDGVLRPLPVTTFDVRCAPAALRYLSQARHTGKVVMLMPGSWAAGTVLITGGTGM
AGSAVARHVVARHGVRNLVLVSRRGPDAPGAAELVAELAAAGAQVQVVACDAADRAALAK
VIADIPVQHPLSGVIHTAGALDDAVVMSLTPDRVDVVLRSKVDAAWHLHELTRDLDVSAF
VMFSSMAGLVGSSGQANYAAANSFLDALAAHRRAHGLPAISLGWGLWDQASAMTGGLATV
DFKRFARDGIVAMSSADALQLFDTAMIVDEPFMLPAHIDFAALKVKFDGGTLPPMFVDLI
NAPTRRQVDDSLAAAKSKSALLQRLEGLPEDEQHAVLLDLVRSHIATVLGSASPEAIDPD
RAFQELGFDSLTAVEMRNRLKSATGLALSPTLIFDYPNSAALAGYMRRELLGSSPQDTSA
VAAGEAELQRIVASIPVKRLRQAGVLDLLLALANETETSGQDPALAPTAEQEIADMDLDD
LVNAAFRNDDE
NT seq 12456 nt NT seq  +upstreamnt  +downstreamnt
atggttgatcaactccagcatgcgaccgaagcgctgcgcaaagcgctggtccaggtggaa
cgcctgaagcgcaccaaccgtgcgttgctggagcgctcgagcgagccgatcgcgatcgtg
ggcatgtcgtgtcgcttcccggggggcgtcgattccccggaagggctgtggcagatggtg
gccgacgccagggacgtgatgtcagaatttcccaccgaccgtgggtgggatctggccggg
ttgttcgacccggatcccgacgtgcgccataagtcgtacgcgcgcactgggggcttcgtg
gatggcgtcgcggatttcgatcccgcgttcttcggtatttcgcccagcgaggcgttagcg
atggatccacagcatcggatgttgctggagttgtcctgggaggcgttggagcgggccggt
atcgatccgaccggattgcgcggcagcgccaccggggtattcgccgggctcatcgtcggc
ggctacggaatgttggccgaggagatcgagggctaccggctgaccgggatgacctccagc
gtcgcctcgggtcgggtggcctatgtgctggggttggagggtccggcggtgtcggtggat
acggcgtgttcgtcgtcgttggtggcgttgcatatggcggtgggatcgctgcggtcgggg
gagtgcgatctggcgctggctggcggcgtcaccgtcaacgccacaccgacggtcttcgtg
gaattcagcaggcatcgtgggctggcacccgacggccggtgcaagccttacgccgggcgg
gctgatggggtcggctggtccgagggcggtgggatgttggtgctgcagcggctttcggat
gcgcggcggttgggtcatccggtgttggcggtggtggtcgggtcggcggttaatcaggat
ggggcgtcgaatgggttgaccgcgcctaatggtccttcgcagcagcgggtggtgcgggcg
gcgttggccaatgccgggttgagcgcggccgaggtggatgtggtggaggggcatgggacc
gggaccacgttgggggatccgattgaggctcaggcgttgttggccacttatgggcaagat
cggggggagccgggagaacctttgtggttggggtcggtgaagtcgaatatgggtcatacg
caggccgcggcgggggtggccggggtgatcaagatggtgttggcgatgcgccatgagctg
ttgccggcgacgttgcacgtggatgtgcctagcccgcatgtggattggtcggcgggggcg
gtggagttgttgaccgcgccgcgggtgtggcctgctggtgctcggacgcgtcgtgcgggg
gtgtcgtcgtttgggattagtggcactaatgcgcatgtgattatcgaggcggtgccggtg
gtgccgcggcgggaggctggttgggcggggccggtggtgccgtgggtggtgtcggcgaag
tcggagtcggcgttgcgggggcaggcggctcggttggccgcgtacgtgcgtggcgatgat
ggcctcgatgttgccgatgtggggtggtcgttggcgggtcgttcggtttttgagcatcgg
gcggtggtggttggcggggaccgtgatcggttgttggccgggctcgatgagctggcgggt
gaccagttgggcggctcggttgttcggggcacggcgactgcggcgggtaagacggtgttc
gtcttccccggccaaggctcccaatggctgggcatgggaatcgaactgctcgataccgca
ccggcattcgcgcagcagatcgacgcgtgtgccgaggcgttcgcggaatttgtcgactgg
tcgctggtggacgtgctgcgtggcgcccccggtgcaccgggactggatcgcgtggatgtg
gtgcagcccgtgctgttcgcggtgatggtgtcactggccgagctgtggaagtcggtcgca
gtgcatccggatgcggtgatcggtcattcgcaaggcgagatcgctgccgcctacgttgcc
ggcgcgctgtcgctgcgcgacgccgcacgggtggtcacgctgcgcagcaagttgctggcc
ggactggccggcccgggcggcatggtgtccatcgcgtgcggtgccgaccaggcgcgggat
ttgttggcgcccttcggcgatcgggtcagcatcgccgtcgtcaacggcccctcggcggtg
gtggtgtcgggcgaagtgggcgcgctggaggagctgatcgcggtgtgctccaccaaggaa
ctgcggacccgccggatcgaggtggactatgcctcgcattcggtggaggtcgaggcgatc
cgtggcccactcgccgaagctctgtccggcatcgaaccgcgatccacgcgtaccgtcttc
ttctctacggtgaccggaaatcgtttggatacagctggtttggacgccgactactggtac
cgcaacgtccgccagaccgtgctattcgaccaggcggtgcgcaacgcctgcgagcagggc
taccgcacgttcatcgaatccagcccgcatccggcgttgattaccggtgtcgaggaaaca
ttcgccgcgtgcaccgacggtgacagcgaggccattgtcgtccccacgctggggcgtgga
gatggtgggctgcaccgattcctgctctcggcggcgtccgcgtttgtggcgggggtggct
gtgaactggcggggcacgctggacggagcgggctatgtggagctgccgacgtatgccttt
gacaagcgccggttttggctctcggccgagggctcaggcgccgacgtatccggtttgggg
ttgggtgcgagcgaacacccgttgctgggcgcggtggtcgacctgcccgcctccggcggg
gtggtgttgacgggtcggttgtcgcccaacgtgcagccgtggttggccgaccacgccgtt
tcagacgtggtgctgttcccgggcaccggattcgtggagctggcgatccgcgccggcgac
gaagtcggctgctcggtgcttgacgagctgacgctggccgcacccctgctgttgcccgcc
accggctccgttgcggtgcaggtggtagtcgacgctggccgggattcgaattcccgtggt
gtgtcgatattttcccgagctgacgcgcaagcgggctggcttttgcatgccgagggtatc
ctgcggcccgggtcggttgaaccaggcgcggacctatcggtgtggccaccggcaggtgcc
gtgacggtggacgtggccgatggctatgagcggttggcgacacgcggctaccggtacgga
ccggcgtttcgcgggctgaccgcgatgtgggcccgcggcgaggaaatattcgccgaggtg
aggctgccggaggcggccgggggagtcggtgggttcggtgtgcatccggctttgttggac
gccgtcttgcatgcggtcgtgatcgccggcgacccggacgaactcgcattgccgttcgct
tggcagggcgtgtcgttgcatgccacgggggcctcggcggtgcgggcccggatcgcgccg
gcggggccgtcggcggtgtcggtggagttggcggacgggctgggtctgccggtattgtcg
gtggcctcgatggtggcccgcccggtgaccgagcggcagctgctggcggcggtgtcgggc
tcgggtcccgaccggctgttcgaagtgatctggtcgcccgcgtcggcggccacgtccccg
gggcctacccccgcctaccagatctttgaatcggttgcggctgaccaagatccggtagcc
ggcagctacgtgcgcagccaccaggctctggccgcagtgcagtcgtggctgaccgaccat
gaatccggggtgctggtggtggcgacccggggcgcgatggcgctgccccgcgaagacgtc
gccgatctggcgggcgcggccgtgtgggggctggtgcggtcggcgcagaccgagcatccg
ggccggatcgtgctggtcgattccgatgcggccaccgacgacgcggcgatcgcgatggcg
ttggcgactggcgagccgcaggtagtgctgcggggcggacaggtgtacaccgcgcgcgtg
cgcggcagccgcgcggcggatgccatcttggtgccgccgggcgatgggccatggcggttg
ggtctgggcagcgcgggcaccttcgaaaatctgcggctcgagccggttcccaacgccgac
gcaccgttggggcccggccaggtccgggtggccatgcgcgccatcgccgcgaacttccgc
gacatcatgatcaccctaggcatgttcacccacgacgcgctgctcggcggcgaaggcgcg
ggcgtggtcgtcgaggtcggccccggtgtcaccgaattctcggtcggtgattcggtgttc
ggattcttccccgacggcagcggcaccctggtggccggcgacgtccggctgctgctgccg
atgcccgccgactggtcctacgccgaagccgccgccatctcggctgtcttcaccaccgcg
tactacgcattcatacatttggccgacgtacaaccgggccagcgcgtgttgatccatgcc
ggcaccggcggggtgggcatggcggcggtgcagctggctcggcatctggggttggaggtg
ttcgcgaccgcgagcaagggtaagtgggacaccttgcgcgccatgggctttgacgacgac
cacatatccgattcacgtagcctagagttcgaggacaagttccgcgcggccactggcggt
cgagggttcgacgtggtgttggactcgctggccggtgaattcgtggatgcgtcgctgcgt
ctggtggcaccgggtggggtgttcttggagatgggcaagaccgacatccgcgaccccggc
gtgatcgcccagcagtacccgggcgtgcgctaccgcgccttcgacctattcgaaccggga
cgtccccggatgcatcagtacatgctggagctcgccacgctgttcggcgatggggtgctg
cggccgttgccggtcaccacttttgacgtgcggcgcgcgcctgcggcgttgcgttatctg
agccaggcgcgccacaccggcaaggtcgtcatgctgatgcccggctcgtgggcggcgggc
acggtgttgatcaccggtggcaccgggatggcgggttcggcggtggcccgtcacgtggtg
gctcgtcatggggtgcgcaatctggtgttggtgagccggcgcggcccggatgctcccggg
gctgcggagctggtggccgagttggccgccgccggtgcgcaggtacaggtggtggcctgt
gacgcggcggatcgagcggcgttggccaaggtgatcgccgatattccggttcagcatcca
ttgtcgggcgtgatccacaccgccggcgcactcgacgacgcggtggtgatgtcactgaca
ccggatcgggtggatgtggtgttgcggtccaaggtggacgcggcgtggcacctgcacgag
ttgactcgcgacctggatgtgtcggcgtttgtcatgttttcgtcgatggccgggctggtc
ggatcgtcgggccaggccaactatgcggccgccaattcgtttttggatgcgctggccgcc
caccggcgggcccatgggctgccggccatctccctgggctggggtctgtgggatcaggcc
agcgccatgaccggcggcctggacgccgcagacctggcccggctgggtcgtgaaggggtg
ctggcgctgtccaccgctgaggcgctggaactgttcgacaccgcaatgatcgtcgacgag
ccattcctggcgcccgcccgcattgacctcaccgcactgcgagcccatgcggtggcggtg
ccgcccatgttctccgacctagccagcgcgccgacccgccgtcaggtcgacgactccgtg
gccgccgcaaagtcgaaatcggcgctcgcgcatcgcctgcacgggctgcccgaagccgaa
cagcacgccgtcttgctaggcctggtgcgtttgcacatcgccaccgtgctgggcaacatc
acgccagaagccatcgaccccgacaaggcgttccaggacctgggttttgactcgttgacc
gcggtcgaaatgcgtaaccggctcaaatccgccaccggcctttcactttcacccacgctc
atcttcgactacccgacacccaatcggctggcctcctatatccgcaccgaacttgccggc
ctcccacaggaaatcaagcacacacccgcggtacgcaccacgagcgaggatccgatcgcg
atcgtgggcatggcgtgccgctatcccggcggggtgaattccccggacgacatgtgggac
atgctgatccagggccgcgacgtgctctccgaattcccggcggaccgcgggtgggacctg
gccgggctatacaaccccgaccccgacgccgcgggtgcgtgctacacccgcaccggcggc
tttgtggacggggtcggcgacttcgaccccgccttcttcggggtggggccgagcgaggcc
ctcgcgatggatccacagcatcggatgttgctggagttgtcctgggaggcgttggagcgg
gccggtatcgatccgaccggattgcgcggcagcgccaccggggtattcgccggggtaatg
acgcaaggctacggcatgttcgccgccgagccggtagaaggcttccggctgaccggccaa
ttgtccagcgtcgcctcgggtcgggtggcctatgtgctggggttggagggtccggcggtg
tcggtggatacggcgtgttcgtcgtcgttggtggcgttgcatatggcggtgggatcgctg
cggtcgggggagtgcgatctggcgctggctggcggcgtcaccgtcaacgccacacccgac
atcttcgtggaattcagccgctggcgcggattatccccggacgggcgctgcaaggcattc
gccgcggcggccgacggcaccggattctccgagggcggtgggatgttggtgctgcagcgg
ctttcggatgcgcggcggttgggtcatccggtgttggcggtggtggtcgggtcggcggtt
aatcaggatggggcgtcgaatgggttgaccgcgcctaatggtccttcgcagcagcgggtg
gtgcgggcggcgttggccaatgccgggttgagcgcggccgaggtggatgtggtggagggg
catgggaccgggaccacgttgggggatccgattgaggctcaggcgttgttggccacttat
gggcaagatcggggggagccgggagaacctttgtggttggggtcggtgaagtcgaatatg
ggtcatacgcaggccgcggcgggggtggccggggtgatcaagatggtgttggcgatgcgc
catgagctgttgccggcgacgttgcacgtggatgtgcctagcccgcatgtggattggtcg
gcgggggcggtggagttgttgaccgcgccgcgggtgtggcctgctggtgctcggacgcgt
cgtgcgggggtgtcgtcgtttgggattagtggcactaatgcgcatgtgattatcgaggcg
gtgccggtggtgccgcggcgggaggctggttgggcggggccggtggtgccgtgggtggtg
tcggcgaagtcggagtcggcgttgcgggggcaggcggctcggttggccgcgtacgtgcgt
ggcgatgatggcctcgatgttgccgatgtggggtggtcgttggcgggtcgttcggttttt
gagcatcgggcggtggtggttggcggggaccgtgatcggttgttggccgggctcgatgag
ctggcgggtgaccagttgggcggctcggttgttcggggcacggcgactgcggcgggtaag
acggtgttcgtcttccccggccaaggctcccaatggctgggcatgggaatgggattgcac
gccggatacccggtgttcgccgaggcgttcaacaccgtagtgggcgaacttgaccggcat
ctgctgcgcccactgcgcgaagtgatgtggggtcacgacgaaaacctactgaacagcacg
gaattcgcgcagcccgcgctgttcgcggtggaagttgccctgttccggttgctgggatcc
tggggtgtacgaccggattttgtcatgggccactcgatcggtgagttgtctgcggcacat
gtcgccggtgtcctgtcgttggagaacgctgcggtgttggtggctgcccgcggccggctc
atgcaggcgttgccggccggtggggcgatggtcgccgtgcaagccgccgaggaagaggtg
cggccgctgctgagcgctgaggttgacatcgctgcggtcaacggtccagcgtcactggtg
atttcgggtgcacaaaacgccgtggccgcggtggccgaccagctgcgcgccgacggacga
cgagtccaccagctggcggtttcccacgcgttccactcgccgttgatggatccgatgatc
gacgaattcgcagccgtcgctgccggaatcgccatcggccggcccaccatcggagtcatc
tccaacgtgaccgggcagttggcgggcgacgatttcggatcagcggcctactggcgacgt
cacatccggcaagccgtgcggttcgccgacagtgtgcgcttcgcgcaggcggccggaggc
agccgattcctcgaagtcgggcccagcggtggccttgttgcgtcgatcgaagagtcgttg
cccgacgttgcggtgacaacgatgtctgcgctgcgcaaggatcgccccgagccggcgacg
ttgaccaacgccgtcgcgcaagggtttgtcaccggtatggacctggattggcgcgctgtg
gtaggcgaggcgcagtttgtcgagttgccgacgtatgccttccaacggcggcggttttgg
ctgtccggtgatggtgtcgcggcggacgcggccggcttggggttggcggccagtgagcac
gcgctcttgggcgcggtgatcgatctgccggcctcgggcggggtggtgttgacgggtcgg
ctgtcgcccagcgtgcagggctggttggccgaccactccgttgccggcgtgacgatcttc
ccgggagcgggatttgtggagttggcgatccgcgccggcgacgaagtgggttgtggcgtt
gtcgacgaattaacgctggccgcgccgttggtgttgcccgcatccggttcggtggcggtt
caggtggtcgtcaatggtcccgacgagtccggcgtgcgcggggtgtcggtgtattcgcgt
ggtgacgtcggtaccggctgggtgttgcacgccgagggcgcgctgcgcgccgggtcggcg
gaaccgaccgcggatctagcgatgtggccgccggcgggcgccgtcccggttgaggtggcg
gacggctatcagcagctggccgagcgcggatacggctacgggccggcgtttcggggactg
accgcgatgtggcgccggggtgatgaggtgttcgcggaggtggcgttgcccgccgatgcc
ggggtctcggtcaccggcttcggggtgcatccggtgctgctggatgcggccttgcacgcg
gtggtgttgagcgcggaaagcgccgagcgtggccaaggttcggtgttggtcccgttctcc
tggcagggggtctcgttgcatgcagcgggggcgtcggcggtgcgggcccgcatcgcgcca
gtgggtccgtcggcggtgtcgatcgagctggccgatgggttgggattgccggtgttgtca
gtcgcttccatgctggcccgaccggtgaccgatcagcaattgcgggcggcggtgtcgagc
tcgggtccggaccggctattcgaggtcacctggtcgccgcagccatcggccgcggtggag
ccgctaccggtgtgcgcctgggggacaacggaggactcggcggcggtggtgtttgagtcg
gtgcctctggccggtgacgtagtggcgggcgtgtatgccgccacgagttcggtgcttgat
gtgttgcagtcgtggctaacccgtgatggggcaggggttttggtggtgatgacccgcggt
gcggtggcattgccgggcgaagatgtcaccgatttggcgggtgccgccgtatggggattg
gtgcggtcggcgcagaccgagcatccgggccggatcgtgctggtcgattccgatgcgccg
ctcgacgattcggccctggcggcggtagtgacgacaggcgagccgcaggtgttgtggcgg
cgcggggaggtttatacggcgcgggtgcacggtagccgcgcggtgggcgggctgttggtt
cctccgagtgaccggccgtggcggttggcgatgagcaccgccggcaccttcgagaatctg
cggctggagctgattcccgatgccgacgcgccgctgggccccgggcaggttcgagttgcg
gtgtccgcgattgccgccaacttccgcgacgtcatgatcgcgctgggtctgtatcccgat
ccggacgcggtcatgggcgttgaggcctgcggcgtcgttatcgaaaccagcttgaacaag
ggatctttcgcggtcggagaccgggtaatgggcctgttccccgagggcaccggaaccgtc
gccagcaccgaccagcggctgctggtcaaggtgccggcggggtggtcgcacacggccgcc
gccaccacctcggtggtgttcgccaccgcccactacgcgctggtggatttggccgctgct
aggtcgggccagcgcgtgttgatccatgccggcaccggcggggtgggcatggcggcggtg
cagctggctcggcatctggggttggaggtgttcgcgaccgcgagcaagggtaagtgggac
accttgcgcgccatgggctttgacgacgaccacatatccgattcacgtagcctagagttc
gaggacaagttccgcgcggccactggcggtcgagggttcgacgtggtgttggactcgctg
gccggtgaattcgtggatgcgtcgctgcgtctggtggcaccgggtggggtgttcttggag
atgggcaagaccgacatccgcgaccccggcgtgatcgcccagcagtacccgggcgtgcgc
taccgcgccttcgacctattcgaaccgggaccggaccgcattgcgcagatccttgccgag
ctcgccacgctgttcggcgatggggtgctgcggccgttgccggtcaccacttttgacgtg
cggtgcgcgcctgcggcgttgcgttatctgagccaggcgcgccacaccggcaaggtcgtc
atgctgatgcccggctcgtgggcggcgggcacggtgttgatcaccggtggcaccgggatg
gcgggttcggcggtggcccgtcacgtggtggctcgtcatggggtgcgcaatctggtgttg
gtgagccggcgcggcccggatgctcccggggctgcggagctggtggccgagttggccgcc
gccggtgcgcaggtgcaggtggtggcctgtgacgcggcggatcgagcggcgttggccaag
gtgatcgccgatattccggttcagcatccattgtcgggcgtgatccacaccgccggcgca
ctcgacgacgcggtggtgatgtcactgacaccggatcgggtggatgtggtgttgcggtcc
aaggtggacgcggcgtggcacctgcacgagttgactcgcgacctggatgtgtcggcgttt
gtcatgttttcgtcgatggccgggctggtcggatcgtcgggccaggccaactatgcggcc
gccaattcgtttttggatgcgctggccgcccaccggcgggcccatgggctgccggccatc
tccctgggctggggtctgtgggatcaggccagcgccatgaccggcggcctggcgacggtg
gacttcaaacgcttcgcccgcgacggcatcgtggcgatgtcgtctgctgacgccctgcaa
ttgttcgacaccgcaatgatcgtcgacgagccattcatgctgcccgcccacatcgacttt
gcggcgttgaaggtcaagttcgatggcggcacgttgccgccgatgttcgtcgatctgatc
aacgcgccgaccaggcgccaggtcgatgactcgttggccgcggcgaaatcgaaatcggct
ctgctgcaacgcctggaaggactgcccgaagacgagcaacacgccgtcctgctggacctg
gtgcgctcgcacatcgccaccgtgctgggtagcgccagccccgaagccatcgacccggat
agggcattccaggagttgggtttcgactcgctcaccgcggtcgaaatgcgcaaccggctc
aaatccgccaccggcctggcgctttcacccacgctcatcttcgactaccccaactccgcg
gcgctggccggctatatgcgtcgagaactgctcggctcatcaccgcaagacacttcagcc
gtggcggccggggaagccgaactacaacgcattgtggcgtccattccggtcaagcgctta
cggcaggcgggagtgctggatctgttgctcgcgctggcaaatgaaaccgaaaccagcggc
caggacccggcgttggcgccgaccgcagaacaagagatcgcggacatggacctcgacgac
ctggtcaacgcggcgtttcggaacgacgacgagtag

DBGET integrated database retrieval system