KEGG   Mycobacterium tuberculosis H37Rv: Rv2064Help
Entry
Rv2064            CDS       T00015                                 

Gene name
cobG
Definition
(RefSeq) precorrin-3B synthase
  KO
K02229  
precorrin-3B synthase [EC:1.14.13.83]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2064 (cobG)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.83  precorrin-3B synthase
     Rv2064 (cobG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
2321451..2322542
Genome map
AA seq 363 aa AA seqDB search
MAGTRDADACPGALRPHQAADGALARIRLPGGMITAAQLATLASVASDFGSATLELTARG
NVQLRGIRDVAAVADAVAKAGLLPSATHERVRNIVASPLSGRAGGLADVRAWVGELDAAI
RAEPRLAELGGRFWFGLDDGRADVSGLGADVGVQVFPDGPRLLLTGRDTGVRVADVAETL
IEVALRFVKIRETAWRVTELADIGELQSGVELGPSVRPVTKTPVGWIPQDDSRVTLGAAV
PLGVLPARVAECLAAIEAPLVITPWRSVLICDLDDATADAALRVLAPLGLVFDENSPWLN
ISACTGSPGCAHSAADVRADAARSLNVESAGHRHFVGCERACGSPPAGEVLVATGGGYRR
LRP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggccgggacccgtgacgcggacgcctgccccggtgcgttgcggccgcaccaggccgcc
gacggggcgctggcgcggatccggctgcccggcgggatgatcaccgcggcacaactggcg
acgctggccagcgtcgccagcgacttcggctccgcgacactggaactgaccgcgcgcggc
aatgtccagttgcgcgggatccgcgacgtggcagcggtcgcggacgcggtcgccaaagcc
gggctgctgccgtcggcaacacacgagcgggtgcgcaatatcgtcgcctcgccgctgtcc
ggccgggccggcgggctagccgacgtgcgggcatgggtcggtgagctcgacgcggcgatc
cgcgccgagccccggctggcggaactgggcggccggttctggttcggtctcgacgacggc
cgcgccgacgtgtccggcctgggtgccgacgtcggcgtgcaggtgttccccgacggtccc
cgactgctgttgaccggacgtgacaccggcgtgcgggtggccgatgtcgccgagaccctg
atcgaggtcgcgttgcgtttcgtcaagatccgcgaaaccgcctggcgagtaacggaatta
gccgatatcggcgagctgcagtccggtgtcgagctgggcccatccgttcggcccgtcacc
aaaacgcccgtcggctggataccccaggatgacagccgggtaacgctgggcgccgcggtg
ccgctgggggtcttgcccgcccgggtcgcggaatgcctggccgcgatcgaggccccgctg
gtgatcacgccgtggcgatcggtgctgatctgcgacctcgacgacgcgacggccgacgcc
gcgctgcgggtgctggcgccgctgggcctggtgttcgacgagaactccccctggctgaac
atcagcgcctgcaccggcagccccggctgcgcgcactcggccgccgacgtacgggccgac
gccgcgcggtcactgaacgtggagtcagccgggcatcggcatttcgtcggctgcgagcgg
gcctgcggcagcccaccggccggcgaggtgctggtcgccaccggcggtggataccggcga
ttgcggccgtag

DBGET integrated database retrieval system