KEGG   Mycobacterium tuberculosis H37Rv: Rv2065Help
Entry
Rv2065            CDS       T00015                                 

Gene name
cobH
Definition
(RefSeq) precorrin-8X methylmutase
  KO
K06042  
precorrin-8X/cobalt-precorrin-8 methylmutase [EC:5.4.99.61 5.4.99.60]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2065 (cobH)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.60  cobalt-precorrin-8 methylmutase
     Rv2065 (cobH)
    5.4.99.61  precorrin-8X methylmutase
     Rv2065 (cobH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
2322552..2323178
Genome map
AA seq 208 aa AA seqDB search
MLDYLRDAAEIYRRSFAVIRAEADLARFPADVARVVVRLIHTCGQVDVAEHVAYTDDVVA
RAGAALAAGAPVLCDSSMVAAGITTSRLPADNQIVSLVADPRATELAARRQTTRSAAGVE
LCAERLPGAVLAIGNAPTALFRLLELVDEGAPPPAAVLGGPVGFVGSAQAKEELIERPRG
MSYLVVRGRRGGSAMAAAAVNAIASDRE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgactacctacgcgacgccgcggaaatctaccggcggtcattcgcggttatccgc
gccgaggccgatctggcgcgcttccccgccgacgtcgcgcgggtggtggttcggttgatt
cacacctgcgggcaggtcgacgtcgccgagcatgtggcctacaccgacgacgtcgtcgcg
cgggcgggtgccgcgctggccgccggtgccccggtgctgtgcgattcgtcgatggtggcc
gccgggatcaccacctcgcggctgcccgccgacaaccagatcgtctcgctggtcgccgat
ccacgcgccaccgagctggccgcccgtcgccagaccacccgatcggcggccggggtcgag
ctgtgtgccgagcggctgcccggcgcggtgctggccataggcaacgcgcccaccgcgctg
tttcggctgctcgaactggtcgacgaaggggcacccccaccggcggccgtgctgggcgga
ccggtgggtttcgtcggatcggcacaggccaaagaggagctcatcgagcggccccgcggg
atgtcctacctggtggtgcgcggtcgccgcggcggcagcgcgatggccgccgccgccgtc
aatgcgatagccagcgaccgcgaatga

DBGET integrated database retrieval system