KEGG   Mycobacterium tuberculosis H37Rv: Rv2066Help
Entry
Rv2066            CDS       T00015                                 

Gene name
cobIJ
Definition
(RefSeq) bifunctional S-adenosyl-L-methionine-precorrin-2 methyl transferase/precorrin-3 methylase
  KO
K13540  
precorrin-2 C20-methyltransferase / precorrin-3B C17-methyltransferase [EC:2.1.1.130 2.1.1.131]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2066 (cobIJ)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.130  precorrin-2 C20-methyltransferase
     Rv2066 (cobIJ)
    2.1.1.131  precorrin-3B C17-methyltransferase
     Rv2066 (cobIJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
2323175..2324701
Genome map
AA seq 508 aa AA seqDB search
MSARGTLWGVGLGPGDPELVTVKAARVIGEADVVAYHSAPHGHSIARGIAEPYLRPGQLE
EHLVYPVTTEATNHPGGYAGALEDFYADATERIATHLDAGRNVALLAEGDPLFYSSYMHL
HTRLTRRFNAVIVPGVTSVSAASAAVATPLVAGDQVLSVLPGTLPVGELTRRLADADAAV
VVKLGRSYHNVREALSASGLLGDAFYVERASTAGQRVLPAADVDETSVPYFSLAMLPGGR
RRALLTGTVAVVGLGPGDSDWMTPQSRRELAAATDLIGYRGYLDRVEVRDGQRRHPSDNT
DEPARARLACSLADQGRAVAVVSSGDPGVFAMATAVLEEAEQWPGVRVRVIPAMTAAQAV
ASRVGAPLGHDYAVISLSDRLKPWDVIAARLTAAAAADLVLAIYNPASVTRTWQVGAMRE
LLLAHRDPGIPVVIGRNVSGPVSGPNEDVRVVKLADLNPAEIDMRCLLIVGSSQTRWYSV
DSQDRVFTPRRYPEAGRATATKSSRHSD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcggggcacgctgtggggagtcgggctggggcccggcgatccggagttggtg
accgtcaaggccgcccgggtgattggcgaggccgatgtggtggcctatcacagcgcccca
cacggtcacagcatcgcccgcggcatcgccgaaccgtatctgcggcccggtcagctcgag
gagcacctggtctacccggtgaccaccgaggccacgaatcatcccggcggctacgccggt
gcgctcgaagacttctacgccgacgcgaccgagcgcatcgccacgcacctggacgccggg
cgcaacgtggcgctgctcgccgaaggcgacccgttgttctacagctcctacatgcatctg
cacacccggctgacgcggcggttcaacgccgtcatcgtgcccggtgtgacgtcggtgagc
gccgcgtcggcggccgtggccacaccgctggtggccggcgaccaggtgttgtcggtgctg
ccgggcacgctgccggtcggcgagctgacccgccggctggccgacgccgacgcggccgtg
gtggtcaagctgggccgttcgtatcacaatgtgcgggaggcgctttcggcgtccggccta
ctcggcgacgcgttctacgtggagcgggccagcaccgccggccaacgggtattgccggcc
gccgacgtcgacgagaccagcgtgccgtacttctcgctggccatgttgccgggcgggcgg
cgtcgtgcgttgctgaccggcaccgtcgcagtggtgggcctggggcccggcgacagcgac
tggatgacaccgcagagccggcgtgagctggccgccgcgacggatctgatcggctatcgc
ggctacctggaccgggtcgaagtccgcgacggccagcggcgccatcccagcgacaacacc
gacgaacccgcccgggcgcggctggcctgctcgctggccgatcagggccgggcggtggcg
gtggtgtcctccggcgacccaggggtattcgcgatggccaccgccgttttggaggaagcc
gagcagtggccgggggtgcgggtccgggtgattccggcgatgaccgccgcccaggccgtc
gccagccgggtcggcgcgccgctgggacatgactacgcggtgatctcgttgtccgaccgg
ctcaaaccctgggacgtgatcgccgcgcgcctgaccgccgcggccgccgccgacctggtg
ctggccatctacaacccggcttcggtgacccgcacctggcaggtcggcgcgatgcgcgag
ctgctgctggcccatcgcgaccctggcataccggtggtgatcggccgcaacgtctccgga
ccggtttccggaccgaatgaggacgttcgggtggtgaagttggccgacctgaaccccgcc
gaaatcgacatgcgctgcctattgatcgtggggtcctcgcagacccggtggtattcggtg
gattcgcaggaccgggtgttcaccccgcgccgctatcccgaggcgggcagagctaccgcg
acaaagtcgagccgccacagcgactga

DBGET integrated database retrieval system