KEGG   Mycobacterium tuberculosis H37Rv: Rv2070cHelp
Entry
Rv2070c           CDS       T00015                                 

Gene name
cobK
Definition
(RefSeq) precorrin-6A reductase
  KO
K05895  
precorrin-6A/cobalt-precorrin-6A reductase [EC:1.3.1.54 1.3.1.106]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2070c (cobK)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.54  precorrin-6A reductase
     Rv2070c (cobK)
    1.3.1.106  cobalt-precorrin-6A reductase
     Rv2070c (cobK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2327491..2328225)
Genome map
AA seq 244 aa AA seqDB search
MTRVLLLGGTAEGRALAKELHPHVEIVSSLAGRVPNPALPIGPVRIGGFGGVEGLRGWLR
EERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPPWDPGTAIIAVSDIEAADVVA
EQGYSRVFLTTGRSGIAAFANSDAWFLIRVVTAPDGTALPRRHKLVLSRGPYGYHDEFAL
LREQRIDALVTKNSGGKMTRAKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAG
LPSR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgacccgggtgttgttgctcggcggcaccgccgagggccgtgcgctggcgaaagagttg
cacccacacgttgagatcgtcagctcgctggccggccgggtacccaaccctgccctgccg
atcggtccggtgcgcatcggcgggttcggcggtgtcgaggggctgcgcggttggctgcga
gaggagcgcatcgatgccgtcgtcgacgccacccaccccttcgcggtaaccatcaccgcg
cacgccgcgcaggtgtgcggtgagctcgggctcccgtacctggtactggctcgcccgccg
tgggatcccggtaccgccatcatcgcggtatcggacatcgaggctgcagacgttgttgct
gaacaaggttattcgcgagtgttcctgaccaccggacgctcgggtattgcggccttcgcc
aacagcgacgcgtggtttttgatccgcgtggttaccgcgcccgatggcaccgccctgccg
cggcggcacaaactggtgctatctcgcgggccatatggttaccacgatgagttcgcactg
ctgcgtgagcagcgcatcgacgcattggtcaccaagaacagcggtggcaagatgacccga
gcgaagctggatgccgctgctgcgctgggtatttcggtggtcatgatagcgcgcccgctg
ctgccggctggggtagcggcggtcgattctgtccaccgggccgccatgtgggtggccggt
ctgcctagccggtga

DBGET integrated database retrieval system