KEGG   Mycobacterium tuberculosis H37Rv: Rv2071cHelp
Entry
Rv2071c           CDS       T00015                                 

Gene name
cobM
Definition
(RefSeq) precorrin-4 C(11)-methyltransferase
  KO
K05936  
precorrin-4/cobalt-precorrin-4 C11-methyltransferase [EC:2.1.1.133 2.1.1.271]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2071c (cobM)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.133  precorrin-4 C11-methyltransferase
     Rv2071c (cobM)
    2.1.1.271  cobalt-precorrin-4 methyltransferase
     Rv2071c (cobM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2328222..2328977)
Genome map
AA seq 251 aa AA seqDB search
MTVYFIGAGPGAADLITVRGQRLLQRCPVCLYAGSIMPDDLLAQCPPGATIVDTGPLTLE
QIVRKLADADADGRDVARLHSGDPSLYSALAEQCRELDALGIGYEIVPGVPAFAAAAAAL
KRELTVPGVAQTVTLTRVATLSTPIPPGEDLAALARSRATLVLHLAAAQIDAIVPRLLDG
GYRPETPVAVVAFASWPQQRTLRGTLADIAARMHDAKITRTAVIVVGDVLTAEGFTDSYL
YSVARHGRYAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacggtctatttcatcggagcgggccccggcgccgccgacctaatcaccgtccgcggc
caacggctcctgcaacgatgcccggtgtgcctgtatgcgggttcgatcatgcccgacgac
ctgttggcgcagtgtccgcccggcgcgacgattgtcgacaccggtccgctgaccctcgaa
caaatcgtgcgcaaacttgccgacgccgacgccgacggccgcgacgttgcccggctgcat
tccggcgacccgtcgctgtacagcgcgctggccgaacagtgccgcgaactcgacgcgctg
ggcatcggctacgaaatcgtgccgggcgtaccggcttttgccgcagccgcggcggcgcta
aagcgcgaactcaccgtgccgggcgtggcgcagacggtgacgctcacccgggtggcgacg
ctgtccacacccataccgcccggtgaggacctggccgcgctcgcccgatcccgcgccact
ctggtcttgcacctggccgcagcccagatcgacgccatcgttccgcgactgctagacggt
ggttaccgacccgaaacgccggttgcggtggtggctttcgcgagttggccgcaacagcgg
acgctacgcggcacgttggccgatatcgccgcgcggatgcacgatgccaagatcaccagg
accgccgtgatcgttgttggcgacgtgctgaccgctgagggctttaccgacagctaccta
tattcggtggcacggcacggtcggtatgcacagtga

DBGET integrated database retrieval system