KEGG   Mycobacterium tuberculosis H37Rv: Rv2124cHelp
Entry
Rv2124c           CDS       T00015                                 

Gene name
metH
Definition
(RefSeq) methionine synthase
  KO
K00548  
5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Selenocompound metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2124c (metH)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2124c (metH)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    Rv2124c (metH)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv2124c (metH)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Rv2124c (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2382489..2386067)
Genome map
AA seq 1192 aa AA seqDB search
MTAADKHLYDTDLLDVLSQRVMVGDGAMGTQLQAADLTLDDFRGLEGCNEILNETRPDVL
ETIHRNYFEAGADAVETNTFGCNLSNLGDYDIADRIRDLSQKGTAIARRVADELGSPDRK
RYVLGSMGPGTKLPTLGHTEYAVIRDAYTEAALGMLDGGADAILVETCQDLLQLKAAVLG
SRRAMTRAGRHIPVFAHVTVETTGTMLLGSEIGAALTAVEPLGVDMIGLNCATGPAEMSE
HLRHLSRHARIPVSVMPNAGLPVLGAKGAEYPLLPDELAEALAGFIAEFGLSLVGGCCGT
TPAHIREVAAAVANIKRPERQVSYEPSVSSLYTAIPFAQDASVLVIGERTNANGSKGFRE
AMIAEDYQKCLDIAKDQTRDGAHLLDLCVDYVGRDGVADMKALASRLATSSTLPIMLDST
ETAVLQAGLEHLGGRCAINSVNYEDGDGPESRFAKTMALVAEHGAAVVALTIDEEGQART
AQKKVEIAERLINDITGNWGVDESSILIDTLTFTIATGQEESRRDGIETIEAIRELKKRH
PDVQTTLGLSNISFGLNPAARQVLNSVFLHECQEAGLDSAIVHASKILPMNRIPEEQRNV
ALDLVYDRRREDYDPLQELMRLFEGVSAASSKEDRLAELAGLPLFERLAQRIVDGERNGL
DADLDEAMTQKPPLQIINEHLLAGMKTVGELFGSGQMQLPFVLQSAEVMKAAVAYLEPHM
ERSDDDSGKGRIVLATVKGDVHDIGKNLVDIILSNNGYEVVNIGIKQPIATILEVAEDKS
ADVVGMSGLLVKSTVVMKENLEEMNTRGVAEKFPVLLGGAALTRSYVENDLAEIYQGEVH
YARDAFEGLKLMDTIMSAKRGEAPDENSPEAIKAREKEAERKARHQRSKRIAAQRKAAEE
PVEVPERSDVAADIEVPAPPFWGSRIVKGLAVADYTGLLDERALFLGQWGLRGQRGGEGP
SYEDLVETEGRPRLRYWLDRLSTDGILAHAAVVYGYFPAVSEGNDIVVLTEPKPDAPVRY
RFHFPRQQRGRFLCIADFIRSRELAAERGEVDVLPFQLVTMGQPIADFANELFASNAYRD
YLEVHGIGVQLTEALAEYWHRRIREELKFSGDRAMAAEDPEAKEDYFKLGYRGARFAFGY
GACPDLEDRAKMMALLEPERIGVTLSEELQLHPEQSTDAFVLHHPEAKYFNV
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
gtgactgcggccgacaagcacctctacgacaccgatctgctcgacgtcttgtcgcagcga
gtgatggtcggcgacggtgcaatgggaacccaactacaggccgcggacctcacgctcgac
gacttccgcggcctggagggctgcaacgagatcctcaacgaaacccgccctgacgtgctg
gaaaccattcaccgcaactatttcgaagcgggcgccgacgccgtcgagacgaacacgttt
ggctgcaacctgtccaacctcggcgactacgacatcgccgacaggatccgcgatctatca
cagaagggcaccgcgatcgcacgccgggtggccgacgagctgggcagtcccgaccgcaag
cgctacgtgctggggtcgatggggccgggcaccaagctgccgactctgggccacaccgaa
tacgcggtgatccgcgacgcctacaccgaggccgcgctgggcatgctggacggcggagcc
gacgccatcctggtggaaacctgccaggacctactgcagctgaaggcggcggtgttgggg
tcgcggcgggcgatgacgcgggccgggcggcacattccggtgtttgcccacgtcaccgtc
gagaccaccggcaccatgctgctgggcagcgagatcggggcggcgttgaccgctgtcgag
ccgctcggtgtggacatgatcggcttgaactgcgcgacgggtccggccgagatgagcgag
cacctgcgccacctgtcccggcacgcccgcatcccggtgtcggtgatgcccaacgccggg
ttgccggtgctgggcgccaagggcgccgaatatccgttgctgcccgacgaattggccgag
gcgctggccggcttcatcgccgagttcgggctctcgctggtcggtggctgctgcggcacc
accccggcccatatccgcgaagtggctgccgcggttgcgaacatcaagcgtcccgagcga
caggtcagctacgagccgtcggtgtcgtcgctgtacaccgcaatcccgttcgcccaggac
gcctcggttctggtgatcggggagcgaacgaacgccaacggctccaagggttttcgtgag
gcgatgatcgccgaggactaccagaagtgcctggacatcgccaaggaccagacccgcgac
ggcgcccacctgctggacctgtgtgtggactacgtgggccgcgacggtgtggccgacatg
aaggcgctggccagccggctggccacgtcctcgacgctgccgatcatgctggactccacc
gaaaccgcggtgctgcaggcgggtttggagcatctgggtggccgttgcgcgatcaactcg
gtgaactacgaggacggcgacggcccggaatcgcgctttgccaagaccatggcgctggtc
gccgagcacggcgcggcggtggtcgcgctgaccatcgacgaagagggccaggcccgcacc
gcgcagaagaaggtcgagatcgccgagcggctgatcaacgacatcaccggcaactggggc
gtcgacgaatcatccatcctcatcgacaccttgacgttcaccatcgccaccggtcaggag
gagtcccgccgcgacggcatcgagaccatcgaggcgatccgcgaactgaaaaagcgccac
ccggatgtgcagaccacacttggtctgtccaacatctcgtttggtctcaatcccgcagcg
cgccaggtgctcaactcggtgttcctgcacgaatgccaagaagcggggctggattcggcg
atcgtgcacgcgtcgaagatcctgccgatgaaccggattcccgaggagcaacgcaacgtc
gccctggatctggtctacgaccgccgccgcgaggactacgatccgctgcaggagctgatg
cggctgttcgaaggcgtgtcggcggcctcctcgaaagaggaccgactggctgaactagct
gggctgccgctgttcgaacggctggcccaacgcatcgtcgacggcgagcgcaacggcctg
gacgccgatctcgacgaggcgatgacgcaaaagccgccgcttcagatcatcaacgaacat
ctgctggccggcatgaagacggtcggcgagctcttcggctccggccagatgcagctgccg
ttcgtgctgcagtcggcggaggtaatgaaagccgccgtcgcgtatctggaaccgcacatg
gagcgctcggacgacgattcgggcaagggacgcatcgtgctggccaccgtcaagggcgac
gtgcacgacatcggcaagaacctggtcgacatcatcttgagcaacaacggctacgaagtg
gtcaacatcggcatcaagcagccaatcgccaccatcctcgaagtcgccgaggacaagagc
gccgacgtggtcggcatgtcgggcctgctggtgaagtcgaccgtggtgatgaaggaaaac
ctcgaggagatgaacacccggggagtcgccgaaaagttcccggtgctgctcggcggcgcg
gcgttgacgcgcagctatgtcgaaaacgacctggccgagatctaccagggcgaagtgcat
tacgcgcgagacgctttcgagggcctgaagttgatggacaccatcatgagcgccaagcgc
ggcgaggcgcccgacgaaaacagcccggaagccattaaggcgcgtgagaaagaagccgaa
cgtaaggcccgccaccagcgatccaaacgcattgccgcacagcgcaaagccgccgaagaa
ccagtcgaggtgcccgaacgctccgatgtcgcggccgacatcgaggtcccggcgccgccg
ttctggggttcgcggatcgtcaagggcctggcggtggccgactacaccggtctgctcgat
gagcgcgcattgtttttgggccagtggggtttacgcggccagcgcggcggtgagggtccg
tcctacgaagatctcgtcgagaccgagggccggccgcggctgcggtactggttggaccgg
ctgtccaccgacggcatcttggcgcacgccgccgtggtgtacggctatttcccggcggtg
tccgagggcaacgacatcgtggtgctcaccgagcccaagcccgacgccccggtgcgctac
cggtttcacttcccgcgccagcagcgcggtcggtttttgtgcattgccgatttcatccgc
tcgcgggagctggccgccgagcgtggcgaggttgacgtgctgccgttccagctggtgacc
atgggtcagccgatcgcggatttcgccaacgagctgttcgcgtccaacgcctaccgcgac
tacctggaggtgcacggtatcggcgtgcagctcaccgaggcgctggccgagtactggcac
cggcggatccgtgaggagctcaagttctccggggatcgggcgatggcggccgaggatccg
gaggcgaaagaagactatttcaagctcggctaccgcggtgctcgctttgccttcggctac
ggcgcatgcccggatctggaggaccgcgccaagatgatggcgctgctggagcccgaacgc
atcggtgtgacgttatccgaggaattacagctgcatcccgaacagtcgaccgacgcgttc
gtcctgcaccatccggaagccaagtacttcaacgtttaa

DBGET integrated database retrieval system