KEGG   Mycobacterium tuberculosis H37Rv: Rv2127Help
Entry
Rv2127            CDS       T00015                                 

Gene name
ansP1
Definition
(RefSeq) L-asparagine permease
  KO
K11738  
L-asparagine permease
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Transporters [BR:mtu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Rv2127 (ansP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2388616..2390085
Genome map
AA seq 489 aa AA seqDB search
MSAASQRVGAFGEEAGYHKGLKPRQLQMIGIGGAIGTGLFLGAGGRLAKAGPGLFLVYGV
CGVFVFLILRALGELVLHRPSSGSFVSYAREFFGEKAAYAVGWMYFLHWAMTSIVDTTAI
ATYLQRWTIFTVVPQWILALIALTVVLSMNLISVEWFGELEFWAALIKVLALMAFLVVGT
VFLAGRYPVDGHSTGLSLWNNHGGLFPTSWLPLLIVTSGVVFAYSAVELVGTAAGETAEP
EKIMPRAINSVVARIAIFYVGSVALLALLLPYTAYKAGESPFVTFFSKIGFHGAGDLMNI
VVLTAALSSLNAGLYSTGRVMHSIAMSGSAPRFTARMSKSGVPYGGIVLTAVITLFGVAL
NAFKPGEAFEIVLNMSALGIIAGWATIVLCQLRLHKLANAGIMQRPRFRMPFSPYSGYLT
LLFLLVVLVTMASDKPIGTWTVATLIIVIPALTAGWYLVRKRVMAVARERLGHTGPFPAV
ANPPVRSRD
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcggcctcacagcgtgtcggcgccttcggcgaagaggccggctatcacaaaggc
ctcaagccccgacaactgcagatgatcgggatcggcggcgcgattgggaccggcctgttc
ctcggcgccggcggccggcttgccaaggccggacctgggttgttcttggtgtacggcgtg
tgcggggtttttgtcttcctgatcctgcgggcgctgggtgagctggtgctgcaccgtccg
tcgtcaggctcgtttgtgtcgtatgcacgtgaatttttcggcgagaaggccgcttacgcg
gtgggctggatgtacttcctgcactgggcgatgacgtcgatcgtggacaccaccgcgatc
gccacctacttgcagcgttggacgatcttcacggtggtcccgcaatggattcttgccctg
atcgccttgacggtggtgttgtcgatgaacctgatttcggtcgaatggttcggcgagctg
gagttttgggccgcgctgatcaaggttctcgcgctgatggcgttcctagtggtgggaacc
gtttttttggccgggcgataccccgtcgacggccacagcaccggattgagcttgtggaac
aaccatggcgggctgttcccgacaagctggctgccgctgctgatcgttacctcgggagtg
gtgttcgcgtactcagcagtcgaattggtagggacggcggccggggagaccgccgagccg
gagaagatcatgccgcgggcgatcaattcggtggtcgctcgcatcgcgatcttttatgtc
gggtcggtggccctgctagcgctgttgctgccgtataccgcctacaaggccggcgagagc
ccgttcgtcacgttcttttccaaaatcggtttccacggtgccggtgacttgatgaacatc
gttgtgcttaccgccgcgctgtcgagcctgaacgcggggctgtattcgaccggccgcgtc
atgcattcgatcgcgatgagcggcagcgccccaaggttcaccgcgcgaatgtcgaaaagc
ggtgtgccctacggcgggatcgtgttgaccgcggtcatcaccctgttcggtgtcgcgctg
aacgccttcaagcccggtgaagccttcgagattgtgctcaacatgtccgcgctgggcatc
atcgcgggttgggccaccatcgtgctgtgtcagcttcgacttcacaagctggccaacgcc
gggatcatgcagcggccgcggttccgcatgcccttctccccctacagcggctacctcacc
ttgctcttcttgcttgtcgtgctggttacgatggcgtccgacaaaccgatcggcacctgg
acggtggcgacactgattattgtcattccggccctgaccgcaggctggtacctggtacgc
aagcgtgtcatggccgtcgcccgcgaaaggctgggtcataccgggccatttccggcggtc
gccaacccgcccgtgaggtcaagagactga

DBGET integrated database retrieval system