KEGG   Mycobacterium tuberculosis H37Rv: Rv2139Help
Entry
Rv2139            CDS       T00015                                 

Gene name
pyrD
Definition
(RefSeq) dihydroorotate dehydrogenase
  KO
K00254  
dihydroorotate dehydrogenase [EC:1.3.5.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rv2139 (pyrD)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.2  dihydroorotate dehydrogenase (quinone)
     Rv2139 (pyrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2398720..2399793
Genome map
AA seq 357 aa AA seqDB search
MYPLVRRLLFLIPPEHAHKLVFAVLRGVAAVAPVRRLLRRLLGPTDPVLASTVFGVRFPA
PLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPRLFRLADDRALLNRMGFN
NHGARALAIRLARHRPEIPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSP
NTPGLRDLQAVESLRPILSAVRAETSTPVLVKIAPDLSDSDLDDIADLAVELDLAGIVAT
NTTVSRDGLTTPGVDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDA
WERITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARRRQPS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtatcccctggtgcgtcggctgttgttcctgatcccacccgagcacgcgcacaagttg
gttttcgccgtgctgcgcggcgtggccgccgtggcgccagtgcgccggctcttgcgccga
ctgctgggcccgacggatccggtgctggccagcacggtgttcggggtgcgcttcccggca
ccgctcgggctggccgcggggttcgacaaggacggcaccgcactatccagttggggtgcg
atggggttcggctacgccgagatcggcaccgtcaccgctcatccgcagcccggcaacccg
gccccccgcctgttccggctggccgacgaccgcgccctgctgaaccggatggggttcaac
aatcacggtgcccgggcactggcgatccgactcgcgcggcaccgacccgagatcccgatc
ggggtgaatatcggcaagaccaagaaaacgccggccggcgacgcggtcaacgactaccgg
gccagcgcccggatggtcggcccgctggcgtcgtatctggtggtcaacgtcagctctccg
aacacaccggggttacgcgatctgcaggcggtcgaatcgctgcggcccatcctgtctgcc
gtccgcgccgagacttcgacgccggtgctggtgaagatcgcgccggacttgtccgattcc
gacctcgacgacatcgcggacctggccgtcgagctagacctggccggcatcgtggcaacc
aacaccacggtgtcacgcgacggcctgaccacaccgggggtcgaccggttgggtcccggc
ggcatctcggggccaccgctggctcagcgcgcggtccaggtgctgcgtcggctctatgac
cgggtcggtgatcgattggcgctgatcagcgtgggcgggatcgagacggccgacgacgcg
tgggagcgcatcacagcgggcgcatcgctgctacagggctataccggcttcatctacggc
ggggaacggtgggccaaggacatccatgaaggcattgcccgcaggctgcatgacggcggg
ttcggctcgctgcacgaagcggtcggctcggcaagacgtcggcaacccagctaa

DBGET integrated database retrieval system