KEGG   Mycobacterium tuberculosis H37Rv: Rv2152cHelp
Entry
Rv2152c           CDS       T00015                                 

Gene name
murC
Definition
(RefSeq) UDP-N-acetylmuramate--alanine ligase
  KO
K01924  
UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rv2152c (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2152c (murC)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     Rv2152c (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Amino acid ligase
   Rv2152c (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2410638..2412122)
Genome map
AA seq 494 aa AA seqDB search
MSTEQLPPDLRRVHMVGIGGAGMSGIARILLDRGGLVSGSDAKESRGVHALRARGALIRI
GHDASSLDLLPGGATAVVTTHAAIPKTNPELVEARRRGIPVVLRPAVLAKLMAGRTTLMV
TGTHGKTTTTSMLIVALQHCGLDPSFAVGGELGEAGTNAHHGSGDCFVAEADESDGSLLQ
YTPHVAVITNIESDHLDFYGSVEAYVAVFDSFVERIVPGGALVVCTDDPGGAALAQRATE
LGIRVLRYGSVPGETMAATLVSWQQQGVGAVAHIRLASELATAQGPRVMRLSVPGRHMAL
NALGALLAAVQIGAPADEVLDGLAGFEGVRRRFELVGTCGVGKASVRVFDDYAHHPTEIS
ATLAAARMVLEQGDGGRCMVVFQPHLYSRTKAFAAEFGRALNAADEVFVLDVYGAREQPL
AGVSGASVAEHVTVPMRYVPDFSAVAQQVAAAASPGDVIVTMGAGDVTLLGPEILTALRV
RANRSAPGRPGVLG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgagcagttgccgcccgatctgcggcgggtgcacatggtcggcatcggcgga
gctggcatgtcgggcatcgcccgaatcctgctggaccgcggcgggctggtctccgggtca
gacgccaaggagtcgcgcggtgtgcatgcgctgcgggcgcggggcgcgttgatccggatc
ggacacgacgcgtcgtcgctggacctgttgcccggtggcgccacggcggtcgtcactacc
catgccgccatccccaaaaccaaccccgagctcgtcgaagcgaggcgccgcggcattccc
gtggtgctgcggccggccgtgctggccaagttgatggccgggcgcaccacattgatggtc
accggcacgcacggcaagacaacgacgacgtccatgctgatcgtcgccctgcagcactgc
gggcttgacccgtcctttgcggtcggcggtgagctgggggaggccggtaccaacgcccat
cacggcagtggcgactgtttcgtcgccgaagccgacgaaagcgatggctcgctgttgcag
tacacaccccacgtcgcggtgatcaccaacatcgagtccgatcacctggacttctacggc
agcgtcgaggcgtatgttgcggtgttcgactccttcgtggagcgcattgtccccgggggt
gcgctggtggtgtgcactgacgaccccggaggggccgcgctggctcagcgcgcgactgag
ctgggaattcgagtgctgcgatacgggtcggtgccgggtgagaccatggcagccacgttg
gtctcgtggcagcaacagggggtcggcgcggtcgcacatatccggttggcctcagaacta
gccacagcacagggtccccgcgtgatgcggctgtcggtgcccgggcgacacatggcgctc
aacgcgctgggagcgctgctggccgcggtgcagatcggcgccccggccgacgaggtgctc
gacgggctggccggcttcgaaggagtgcggcgacgattcgaactggttgggacctgcggc
gtcggaaaggcgtcggtgcgcgtgttcgatgactacgcccaccacccgacggagatcagc
gcgacactggcggcggcgcgcatggtgctcgaacagggcgacggtggccgctgcatggtt
gtgtttcaaccccatttgtattcgcggacaaaggcattcgctgctgagtttgggcgtgcg
ctgaatgccgctgacgaggtgttcgtactcgacgtctacggagctcgtgaacaaccgctg
gccggtgtcagcggagccagcgtcgctgagcacgtcactgtgccgatgcgctacgtcccg
gatttttcggcggtcgcacagcaagtggccgccgccgctagtccgggcgacgtcatcgtc
acgatgggtgccggagacgtgaccttgctgggcccggaaatcctgaccgcccttcgggtc
cgggccaaccgaagcgcccccggccgtccgggggtgctgggatga

DBGET integrated database retrieval system