KEGG   Mycobacterium tuberculosis H37Rv: Rv2153cHelp
Entry
Rv2153c           CDS       T00015                                 

Gene name
murG
Definition
(RefSeq) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase
  KO
K02563  
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2153c (murG)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rv2153c (murG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Rv2153c (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Glycosyltransferase
   Rv2153c (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2412119..2413351)
Genome map
AA seq 410 aa AA seqDB search
MKDTVSQPAGGRGATAPRPADAASPSCGSSPSADSVSVVLAGGGTAGHVEPAMAVADALV
ALDPRVRITALGTLRGLETRLVPQRGYHLELITAVPMPRKPGGDLARLPSRVWRAVREAR
DVLDDVDADVVVGFGGYVALPAYLAARGLPLPPRRRRRIPVVIHEANARAGLANRVGAHT
ADRVLSAVPDSGLRRAEVVGVPVRASIAALDRAVLRAEARAHFGFPDDARVLLVFGGSQG
AVSLNRAVSGAAADLAAAGVCVLHAHGPQNVLELRRRAQGDPPYVAVPYLDRMELAYAAA
DLVICRAGAMTVAEVSAVGLPAIYVPLPIGNGEQRLNALPVVNAGGGMVVADAALTPELV
ARQVAGLLTDPARLAAMTAAAARVGHRDAAGQVARAALAVATGAGARTTT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacacggtcagccagccggccggcgggcgcggggcaacggcgccccggcccgcc
gatgccgcctcgccgtcttgtggttcctcgccgtctgctgattccgtgtcggtcgttctc
gccggcggcgggaccgccgggcacgtcgagcccgccatggccgtcgccgacgccttggtc
gcgttggatccgcgcgtccggattaccgcgttgggcaccctccgtggactagagaccagg
ctggtgccccagcgcggctaccacctggagctgatcacggcggtgccgatgccgcgcaag
cccggcggcgacctggcccggctgccgtcgcgggtgtggcgcgccgtccgggaggcccgg
gacgtgctcgacgatgtcgacgccgacgtcgtcgtcggtttcggtgggtacgtcgcgcta
ccggcttacctagccgctcgcggcctgcctttgccgccccggcgccggcgccggatcccg
gtggtgatccacgaagccaacgccagggcgggactggccaaccgggtcggcgcccatacc
gcggaccgggtgctctccgcggtgccggattccgggctgcggcgcgccgaggtggttggg
gtcccggtccgtgcgtcgatcgccgcgctggaccgcgcggtgctgcgagccgaggcgcgg
gcacacttcggcttccccgacgacgcgcgggtgctgctggtgttcgggggttcgcagggc
gcggtctcgctcaaccgggcggtgtccggcgccgccgccgacctggccgccgccggtgtt
tgcgtgctgcatgcccatggaccccagaacgtgctggagttgcgccgtcgggctcaaggt
gacccaccgtacgtggcggtgccctatttggaccggatggagctggcctacgccgccgcc
gatctggtgatctgccgggccggggcgatgacggtcgccgaagtatccgccgtcggtctg
ccggccatctacgtgccgctgccgatcggcaacggtgaacagcggctgaatgcgttgccg
gtagtcaatgccggcggcggcatggtggtcgccgacgccgccctgacccccgagttggtg
gcccgccaggttgccgggctgctcaccgaccccgcgcggctggccgcgatgaccgcggcc
gcagccagggtgggacatcgcgatgccgcgggccaggtggcccgggccgcgctggccgtc
gccaccggggccggtgccaggacaacgacgtga

DBGET integrated database retrieval system