KEGG   Mycobacterium tuberculosis H37Rv: Rv2155cHelp
Entry
Rv2155c           CDS       T00015                                 

Gene name
murD
Definition
(RefSeq) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  
UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Rv2155c (murD)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2155c (murD)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Rv2155c (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Amino acid ligase
   Rv2155c (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2414934..2416394)
Genome map
AA seq 486 aa AA seqDB search
MLDPLGPGAPVLVAGGRVTGQAVAAVLTRFGATPTVCDDDPVMLRPHAERGLPTVSSSDA
VQQITGYALVVASPGFSPATPLLAAAAAAGVPIWGDVELAWRLDAAGCYGPPRSWLVVTG
TNGKTTTTSMLHAMLIAGGRRAVLCGNIGSAVLDVLDEPAELLAVELSSFQLHWAPSLRP
EAGAVLNIAEDHLDWHATMAEYTAAKARVLTGGVAVAGLDDSRAAALLDGSPAQVRVGFR
LGEPAARELGVRDAHLVDRAFSDDLTLLPVASIPVPGPVGVLDALAAAALARSVGVPAGA
IADAVTSFRVGRHRAEVVAVADGITYVDDSKATNPHAARASVLAYPRVVWIAGGLLKGAS
LHAEVAAMASRLVGAVLIGRDRAAVAEALSRHAPDVPVVQVVAGEDTGMPATVEVPVACV
LDVAKDDKAGETVGAAVMTAAVAAARRMAQPGDTVLLAPAGASFDQFTGYADRGEAFATA
VRAVIR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgaccctctggggccgggtgcgcccgtgttggtagccggtggccgggtgaccggt
caggcggtggccgcggtgctgactcggtttggtgcgacgccgacggtgtgcgacgacgat
ccggtcatgctgcgaccgcacgccgaacgtgggctgccgaccgttagttcctcggacgcg
gtgcagcagataaccgggtatgcgctggtggtcgccagtcccggcttctcgcccgcaacc
ccgctactggccgcggccgcggcggcgggggtgccgatctggggtgacgtggagttagcc
tggcggctagacgcagcgggctgctacggaccgccgcgcagctggctggtggtgaccggc
accaacggcaagaccaccacgacgtcgatgctgcacgccatgctgatcgccggtggccgc
cgcgccgtgctgtgcggcaatatcggcagtgcggtgctggatgtgctggacgagccggcc
gagctgctggccgtggagttgtccagtttccagctgcactgggcgccgtcgctgcggccc
gaggccggcgcggtgctcaacattgccgaagaccacctggactggcatgccacgatggcc
gaatacaccgcggccaaggcccgggtgctgaccggcggggtagcggtggccgggctggat
gacagccgagcggccgcactgctggacggctcaccggcgcaggtgcgggtcggcttccgg
ctcggcgagccggccgcgcgggaactgggcgtgcgcgacgcccacctggtcgatcgcgcc
ttctccgacgacttgacgctgctgccggtcgcgtcgataccggtgccaggtccggtcggc
gtgcttgacgccctggccgcggcggcgctggcccgctcggtcggggtgcccgccggtgcg
atcgccgacgcggtcacgtcgtttcgagtgggccgacaccgcgccgaggtggtggccgtt
gccgacggcatcacctacgtggacgactccaaggccaccaacccgcacgccgcgcgggct
tcggtgcttgcatacccgagggtggtatggatcgccggtggcctgctcaagggcgcgtcg
cttcacgccgaggttgcggcgatggcgtcgcggctggtcggtgcggtgctgatcggccgg
gatcgcgcagcggttgccgaggcgttatcacgacacgcgcccgatgtcccagtcgttcag
gttgtggcaggcgaggatactggtatgcctgcgactgttgaggttcctgttgcttgtgtt
ctagatgtggcaaaagatgacaaagccggtgagaccgttggcgctgccgtgatgaccgct
gcggtggccgcggcccggcggatggcccaacccggtgacaccgtgctgctggcaccggcc
ggcgcctcattcgaccagttcaccggttatgccgaccggggcgaggcattcgcgaccgcg
gtccgcgcggtgatccggtag

DBGET integrated database retrieval system