KEGG   Mycobacterium tuberculosis H37Rv: Rv2157cHelp
Entry
Rv2157c           CDS       T00015                                 

Gene name
murF
Definition
(RefSeq) UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase
  KO
K01929  
UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [EC:6.3.2.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2157c (murF)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2157c (murF)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Rv2157c (murF)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     Rv2157c (murF)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Amino acid ligase
   Rv2157c (murF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2417472..2419004)
Genome map
AA seq 510 aa AA seqDB search
MIELTVAQIAEIVGGAVADISPQDAAHRRVTGTVEFDSRAIGPGGLFLALPGARADGHDH
AASAVAAGAAVVLAARPVGVPAIVVPPVAAPNVLAGVLEHDNDGSGAAVLAALAKLATAV
AAQLVAGGLTIIGITGSSGKTSTKDLMAAVLAPLGEVVAPPGSFNNELGHPWTVLRATRR
TDYLILEMAARHHGNIAALAEIAPPSIGVVLNVGTAHLGEFGSREVIAQTKAELPQAVPH
SGAVVLNADDPAVAAMAKLTAARVVRVSRDNTGDVWAGPVSLDELARPRFTLHAHDAQAE
VRLGVCGDHQVTNALCAAAVALECGASVEQVAAALTAAPPVSRHRMQVTTRGDGVTVIDD
AYNANPDSMRAGLQALAWIAHQPEATRRSWAVLGEMAELGEDAIAEHDRIGRLAVRLDVS
RLVVVGTGRSISAMHHGAVLEGAWGSGEATADHGADRTAVNVADGDAALALLRAELRPGD
VVLVKASNAAGLGAVADALVADDTCGSVRP
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagctgaccgtcgcgcagatcgccgagatcgtcgggggcgcagtggccgatatc
tccccgcaagacgccgcgcaccgccgcgtcaccgggaccgtcgagttcgactcgcgcgcc
atcggcccgggcgggctgttcctcgccctgccgggggcgcgcgccgacggccacgaccat
gccgcgtcggcggtagccgcgggcgccgccgtcgtgctggccgcccgcccggtgggggtg
ccggccatcgtggttccgccagtggccgcgccgaacgtattggccggcgtcctcgagcac
gacaacgacgggtcgggggcggcggtgctggccgcgctggccaagctggccaccgcggtg
gccgcgcagttggtggccggcgggctcaccatcatcgggatcaccggctcgtcgggcaag
acgtcgaccaaggacctgatggccgccgtgctggccccgctgggggaggtggtggccccg
cccggatcgttcaacaacgagctgggtcacccgtggacggtgctgcgcgcgacgcggcgc
accgactacctgattttggagatggcggcacgccatcacggcaacatcgccgcgctcgcc
gagatcgcgcccccgtcgatcggagtcgtgctcaacgtcggcaccgcacatttgggtgag
ttcggctcccgcgaggtcatcgcacagaccaaagccgaactgccgcaggctgttccgcat
tccggagcggtcgtcctcaacgctgatgaccccgcggtggcggcgatggccaagctgacc
gcggcccgggtggtgcgggtcagccgggacaacaccggtgacgtttgggcggggccggtg
tcgctggacgaattggccaggccgcgctttacgctgcatgcccacgatgcccaagccgag
gtccgactcggggtctgcggcgaccaccaggtcactaacgcgctgtgcgccgcggcggtc
gcgctggagtgtggggccagcgttgaacaggtcgcggccgcgctgaccgcggcgccgccg
gtgtcgcggcatcggatgcaggtgaccacccgcggcgacggggtgacggtgatcgacgac
gcctacaacgccaaccccgactccatgcgggccgggctgcaggcgctggcctggatcgcg
caccaacccgaggccacccgccgcagctgggcggtgctgggtgagatggccgagctgggt
gaggacgcgatagccgagcacgatcgcatcggccggctcgcggtgcgcttagatgtgtct
cgactcgttgtcgtgggaaccgggaggtcgatcagcgccatgcaccacggagcggtcctg
gagggggcgtggggctcgggggaagccactgctgatcacggtgcggatcgcacggccgtc
aatgtggccgacggtgacgccgccctggcactactgcgcgccgagctgcgacccggggat
gtggtcttggtcaaggcctcgaacgcggccgggctgggtgcggtggccgatgcattggtc
gcagacgacacatgcgggagtgtgcgcccatga

DBGET integrated database retrieval system