KEGG   Mycobacterium tuberculosis H37Rv: Rv2178cHelp
Entry
Rv2178c           CDS       T00015                                 

Gene name
aroG
Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase AroG
  KO
K01626  
3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2178c (aroG)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2178c (aroG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Rv2178c (aroG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Rv2178c (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2440332..2441720)
Genome map
AA seq 462 aa AA seqDB search
MNWTVDIPIDQLPSLPPLPTDLRTRLDAALAKPAAQQPTWPADQALAMRTVLESVPPVTV
PSEIVRLQEQLAQVAKGEAFLLQGGDCAETFMDNTEPHIRGNVRALLQMAVVLTYGASMP
VVKVARIAGQYAKPRSADIDALGLRSYRGDMINGFAPDAAAREHDPSRLVRAYANASAAM
NLVRALTSSGLASLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACGVADRNLQT
AEIYASHEALVLDYERAMLRLSDGDDGEPQLFDLSAHTVWIGERTRQIDGAHIAFAQVIA
NPVGVKLGPNMTPELAVEYVERLDPHNKPGRLTLVSRMGNHKVRDLLPPIVEKVQATGHQ
VIWQCDPMHGNTHESSTGFKTRHFDRIVDEVQGFFEVHRALGTHPGGIHVEITGENVTEC
LGGAQDISETDLAGRYETACDPRLNTQQSLELAFLVAEMLRD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaccgtcgacataccgatcgaccagctcccgtcgcttccgccgctgccgact
gacctgcgaacacgactggacgccgcgctggccaagccggcggcccagcaacccacctgg
ccggccgaccaggcgttggcgatgcgcacggtgttggagagcgtgccacccgtgacggtg
ccgtccgagatcgtccggctgcaagagcagctggcccaggtggcaaagggtgaggctttc
ctgctgcagggcggcgactgcgctgagacattcatggacaacaccgaaccccatattcgg
ggcaatgtccgtgccttgttgcagatggccgtggtgctgacctacggcgccagcatgcca
gtggtgaaggtggcccgcatcgccggtcagtacgcgaagcctcggtcagccgacattgac
gcgctgggtctgcggtcttaccgcggcgacatgatcaacggcttcgccccggacgccgcg
gcgcgcgagcacgacccgtcgcggctggtccgggcttacgctaacgccagtgcggcgatg
aacttggtgcgtgcgctgacttcgtcgggcctggcgtcgctgcatctggttcacgactgg
aaccgggaattcgtccggacctcgccggccggcgcgcgctatgaggcgctggccaccgag
atcgatcgtgggctgcggttcatgagtgcctgtggggtggccgaccgcaatctacagacc
gccgaaatctatgccagccatgaagctttggtgctcgactacgagcgcgccatgttgagg
ttgtccgacggtgacgacggtgaaccacaactgtttgacctgtccgcacacaccgtgtgg
atcggcgagcggacccgacaaatcgatggcgcgcacatcgcgtttgcccaggtgattgct
aatccggtcggggtcaagttgggccccaacatgaccccggaactggccgtggagtacgtc
gagcggctcgacccgcacaataagccgggccggctgacgttggtgagcaggatgggcaac
cacaaggtccgcgatctgttgccaccgatcgtggagaaggtccaggccaccgggcatcag
gtgatctggcaatgcgacccgatgcacggcaacacccacgagtcgtccacggggttcaag
acccgtcacttcgatcgcattgtcgatgaagtgcagggttttttcgaggtgcatcgtgcc
ctcggaacccatccgggcggcatccatgtcgagattaccggcgagaacgtcaccgaatgt
cttggtggcgcgcaagacatttcggagacggacttggccggccgctatgagacggcatgt
gatccgcggctgaacacccagcagtcgctggagttggcgttcctggtcgcggagatgctg
cgggactag

DBGET integrated database retrieval system