KEGG   Mycobacterium tuberculosis H37Rv: Rv2192cHelp
Entry
Rv2192c           CDS       T00015                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2192c (trpD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Rv2192c (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 887681
NCBI-ProteinID: NP_216708
TubercuList: Rv2192c
UniProt: P9WFX5
Structure
PDB: 

Jmol
Position
complement(2455631..2456743)
Genome map
AA seq 370 aa AA seqDB search
MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPA
QIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLST
MAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAP
RFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS
VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAA
VRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLL
ARWVRFGRQI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgtcagctgagggttcttcggggggatctcgcgggggctcgccgaaagcagaa
gccgcatcggtgccgtcctggccgcagattttggggcggttgaccgacaaccgcgatctg
gcgcggggccaggctgcctgggccatggaccagatcatgaccggcaatgcgcggccggcg
cagatcgccgccttcgcggtggcgatgacgatgaaggctccgaccgccgacgaagtcggt
gagctcgctggcgtcatgctcagccacgcgcatccgttgcccgccgatacggtccccgac
gacgccgtcgacgtcgtcggcaccggtggcgacggagtcaacacggtgaacctatccacc
atggcggcgattgtggtggcggctgcgggtgtgccggtggtcaagcacggcaaccgagcg
gcgtcctcgttgtccggtggcgccgacacgctggaggcgctgggggtgcgcatcgacctg
ggacccgacctggtcgcgcgcagcctcgcggaggttgggatcgggttctgcttcgcgccg
cggttccatccctcctaccggcacgcggccgcggtacgccgcgagatcggtgtgcccacc
gtgttcaatcttctcgggccgctgaccaatccggcccggccccgggctggactgatcgga
tgcgcgttcgccgacctcgccgaagtgatggccggggtgtttgctgcgcgccggtccagt
gtgctggtggtacacggcgacgatgggctggacgagttgaccaccaccaccacgagcacg
atctggcgcgttgcggcgggcagcgtggataagttgacgtttgatcccgccggattcggg
tttgcgcgcgcccagcttgaccagctggctggaggcgatgcgcaagccaacgcggccgcg
gtgcgcgcggtgttgggcggtgccaggggcccggtccgggacgctgtggtgctcaacgcc
gccggtgcgatcgtcgcccacgccggattatccagccgtgctgaatggctgccggcctgg
gaggaggggttgcggcgggccagtgcggcaatcgacaccggtgcggccgaacagttgctc
gcgcgatgggtgcggttcggtcggcagatctga

DBGET integrated database retrieval system