KEGG   Mycobacterium tuberculosis H37Rv: Rv2192cHelp
Entry
Rv2192c           CDS       T00015                                 

Gene name
trpD
Definition
(RefSeq) anthranilate phosphoribosyltransferase
  KO
K00766  
anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rv2192c (trpD)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2192c (trpD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Rv2192c (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2455631..2456743)
Genome map
AA seq 370 aa AA seqDB search
MALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPA
QIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLST
MAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAP
RFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSS
VLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAA
VRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLL
ARWVRFGRQI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctgtcagctgagggttcttcggggggatctcgcgggggctcgccgaaagcagaa
gccgcatcggtgccgtcctggccgcagattttggggcggttgaccgacaaccgcgatctg
gcgcggggccaggctgcctgggccatggaccagatcatgaccggcaatgcgcggccggcg
cagatcgccgccttcgcggtggcgatgacgatgaaggctccgaccgccgacgaagtcggt
gagctcgctggcgtcatgctcagccacgcgcatccgttgcccgccgatacggtccccgac
gacgccgtcgacgtcgtcggcaccggtggcgacggagtcaacacggtgaacctatccacc
atggcggcgattgtggtggcggctgcgggtgtgccggtggtcaagcacggcaaccgagcg
gcgtcctcgttgtccggtggcgccgacacgctggaggcgctgggggtgcgcatcgacctg
ggacccgacctggtcgcgcgcagcctcgcggaggttgggatcgggttctgcttcgcgccg
cggttccatccctcctaccggcacgcggccgcggtacgccgcgagatcggtgtgcccacc
gtgttcaatcttctcgggccgctgaccaatccggcccggccccgggctggactgatcgga
tgcgcgttcgccgacctcgccgaagtgatggccggggtgtttgctgcgcgccggtccagt
gtgctggtggtacacggcgacgatgggctggacgagttgaccaccaccaccacgagcacg
atctggcgcgttgcggcgggcagcgtggataagttgacgtttgatcccgccggattcggg
tttgcgcgcgcccagcttgaccagctggctggaggcgatgcgcaagccaacgcggccgcg
gtgcgcgcggtgttgggcggtgccaggggcccggtccgggacgctgtggtgctcaacgcc
gccggtgcgatcgtcgcccacgccggattatccagccgtgctgaatggctgccggcctgg
gaggaggggttgcggcgggccagtgcggcaatcgacaccggtgcggccgaacagttgctc
gcgcgatgggtgcggttcggtcggcagatctga

DBGET integrated database retrieval system