KEGG   Mycobacterium tuberculosis H37Rv: Rv2202cHelp
Entry
Rv2202c           CDS       T00015                                 

Gene name
adoK
Definition
(RefSeq) adenosine kinase
  KO
K00856  
adenosine kinase [EC:2.7.1.20]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv2202c (adoK)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     Rv2202c (adoK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2467053..2468027)
Genome map
AA seq 324 aa AA seqDB search
MTIAVTGSIATDHLMRFPGRFSEQLLPEHLHKVSLSFLVDDLVMHRGGVAGNMAFAIGVL
GGEVALVGAAGADFADYRDWLKARGVNCDHVLISETAHTARFTCTTDVDMAQIASFYPGA
MSEARNIKLADVVSAIGKPELVIIGANDPEAMFLHTEECRKLGLAFAADPSQQLARLSGE
EIRRLVNGAAYLFTNDYEWDLLLSKTGWSEADVMAQIDLRVTTLGPKGVDLVEPDGTTIH
VGVVPETSQTDPTGVGDAFRAGFLTGRSAGLGLERSAQLGSLVAVLVLESTGTQEWQWDY
EAAASRLAGAYGEHAAAEIVAVLA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcgcggtaaccggttcgattgcgaccgaccatttgatgcggtttccaggccga
ttttccgagcagctactgcccgaacacctgcacaaggtgtcgcttagcttcctagtcgat
gacttggtgatgcaccgcggcggcgtggccggaaacatggccttcgccatcggtgtgcta
ggtggcgaggtcgcgctagttggggcggcaggcgccgacttcgccgattatcgcgactgg
ctgaaagcccgcggtgtcaactgcgaccacgttctgatctccgagaccgcgcacacggcg
cggtttacctgtaccaccgatgtcgacatggcccagatcgcatcgttctaccccggggct
atgtcggaggcacgtaacatcaagcttgccgacgtggtgtcggccatcggcaagccggag
ttggtgatcatcggcgccaacgaccccgaggcgatgttcttgcacaccgaggagtgtcgc
aagctggggctggccttcgccgccgatccgtctcagcagctggcgaggctgtcgggtgag
gaaattcgcaggctcgtcaacggtgctgcttacttgttcaccaacgactacgaatgggat
ctgctgctgtccaagaccggctggtcagaggccgatgtgatggcgcagatcgacctgcgg
gtgaccacattgggtcctaagggtgtcgatttggtagaacctgacggcaccaccatccac
gtcggcgtggtccccgaaaccagccagaccgaccccaccggcgtcggcgacgcgttccgc
gccggtttcctgactggccgcagtgccggactaggcctggagcgttcggcgcagctgggc
tcgctggttgccgtgctggtgctggagtcgaccggaactcaggagtggcagtgggactac
gaggccgcggccagcaggctggctggtgcttacggcgagcacgcggccgccgagatcgtc
gccgtgctggcctag

DBGET integrated database retrieval system