KEGG   Mycobacterium tuberculosis H37Rv: Rv2205cHelp
Entry
Rv2205c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K00865  
glycerate 2-kinase [EC:2.7.1.165]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Glycerolipid metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2205c
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rv2205c
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv2205c
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Rv2205c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2469387..2470463)
Genome map
AA seq 358 aa AA seqDB search
MRVLVAPDCYGDSLSAVEAAAAIATGWTRSRPGDSFIVAPQSDGGPGFVEVLGSRLGETR
RLRVCGPLNTVVNAAWVFDPGSATAYLECAQACGLGLLGGPPTPETALAAHSKGVGQLIA
AALRAGAARIVVGLGGSACTDGGKGMIAELGGLDAARRQLADVEVIAASDVEYPLLGPWG
TARVFAPQKGADMATVAVLEGRLAAWAIELDAAAGRGVSAEPGAGAAGGIGAGLLAVGGR
YQSGAAIIAEHTHFADDLADAELIVTGEGRFDEQSLHGKVVGAIAAAARPLAIPVIVLAG
QVSLDKSALRSAGIMAALSIAEYAGSVRLALADAANQLMGLASQVAARLGNSGPSGYR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgttggtggcaccggactgctacggcgacagcctgtctgcggtggaggccgcc
gcggccattgcgaccggctggacgcggtcgcgaccaggcgattcgttcatcgtcgccccc
caatccgatggcggtccgggttttgttgaggtgctgggcagccggctaggagagacccgc
cggctgcgtgtttgcgggccactgaacaccgtcgtgaacgcggcgtgggtgttcgatccg
ggctcggcaaccgcgtatttggagtgtgcgcaggcttgtggtctggggttgcttggcggc
ccgcccacgcccgagaccgcgctggcggcccacagcaagggcgtcggccagctcatcgcc
gcggcactgcgggccggggcggctcggatcgtggtggggttggggggcagcgcatgtacc
gacggggggaaggggatgattgccgagcttggcggcctggacgcggcccgccgacagttg
gccgacgtcgaggtgatcgccgcctcggatgtcgaatacccattgctgggaccatggggc
acggccagggtgttcgcgccgcagaagggcgcggacatggccaccgtcgcagtgttggaa
ggccgtctggcggcatgggcgattgaactggacgcggccgccgggcgcggggtgagcgcc
gagccgggcgcgggcgccgccggtggtatcggggctgggctgctcgcggttggcggccgg
taccagtcgggtgcggcaatcatcgcagagcacacgcattttgccgacgaccttgccgat
gcggagctgatcgtcaccggtgagggccgattcgacgagcaatccctgcacgggaaggtg
gttggtgcgatcgcggctgcggcccgcccgctcgcaattccggtgatagtgttggccggc
caggtgtcgctggacaagtccgcgttgcggtcggcgggcattatggccgcattgtccatc
gctgagtacgccggttcggtgcggttggcgctggccgatgcggccaatcagctcatgggc
ttggcgtctcaggtagcggcgcgactcgggaatagcggtccttcagggtaccgttga

DBGET integrated database retrieval system