KEGG   Mycobacterium tuberculosis H37Rv: Rv2208Help
Entry
Rv2208            CDS       T00015                                 

Gene name
cobS
Definition
(RefSeq) adenosylcobinamide-GDP ribazoletransferase
  KO
K02233  
adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2208 (cobS)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     Rv2208 (cobS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2472493..2473242
Genome map
AA seq 249 aa AA seqDB search
MMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWAGAQVFGPSSP
LSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALAVMRDGSTGPFGVAAVVLVIA
LQGLAFATLTTVGIAGITLAVLSGRVTAVLVCRRLVPAAHGSTLGSRVAGTQPAPVVAAW
LAVLLAVSVPAGPRPWQGPIAVLVAVTAGAALAAHCVHRFGGVTGDVLGSAIELSTTVSA
VTLAGLARL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcgttcgctggcaacagctttcgcattcgcaacggtgatacccacaccgggctca
gcgaccaccccgatgggccgtggcccgatgaccgcgctgccggtggtgggcgcggcgctg
ggtgcactggcggcggcgatcgcatgggctggcgcgcaagtgttcggcccgtccagcccg
ctgtccggcatgctcacggtggcggtactgctggtcgtcactcgaggcctgcacatcgat
ggcgttgccgataccgctgacggactgggctgctatgggccgccgcagcgtgcgcttgcg
gtgatgcgcgacgggtcgaccggaccgttcggggtggcggccgtggtcttggtcatcgcc
ttgcagggcctggccttcgcgaccctcaccacggtcgggatcgctgggatcacgctggcg
gtcttatccggccgggtcaccgccgtactggtctgtcgccggttggtgccggcagcccac
ggcagcaccctgggctcgcgggtcgccggtacgcaacccgcgccggtggtggcggcctgg
ctcgccgtcctgctcgccgtttcggtgccggccggtccccggccttggcaaggaccgata
gcggttctggtagcggtgacggccggcgcggccctggcggcgcattgcgtgcaccggttc
ggcggtgtcaccggtgacgtgctgggcagcgcgatcgagctgagcacgacggtcagcgcc
gtgacgcttgcgggcttggcccggctttag

DBGET integrated database retrieval system