KEGG   Mycobacterium tuberculosis H37Rv: Rv2210cHelp
Entry
Rv2210c           CDS       T00015                                 

Gene name
ilvE
Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Rv2210c (ilvE)
   01230 Biosynthesis of amino acids
    Rv2210c (ilvE)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2210c (ilvE)
   00280 Valine, leucine and isoleucine degradation
    Rv2210c (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    Rv2210c (ilvE)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv2210c (ilvE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Rv2210c (ilvE)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class IV
   Rv2210c (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2474864..2475970)
Genome map
AA seq 368 aa AA seqDB search
MTSGSLQFTVLRAVNPATDAQRESMLREPGFGKYHTDHMVSIDYAEGRGWHNARVIPYGP
IELDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRADANAARLRSSARRLAIPELPDAVFI
ESLRQLIAVDKAWVPGAGGEEALYLRPFIFATEPGLGVRPATQYRYLLIASPAGAYFKGG
IAPVSVWVSTEYVRACPGGTGAAKFGGNYAASLLAQAEAAENGCDQVVWLDAVERRYIEE
MGGMNIFFVLGSGGSARLVTPELSGSLLPGITRDSLLQLAIDAGFAVEERRIDIDEWQKK
AAAGEITEVFACGTAAVITPVARVRHGASEFRIADGQPGEVTMALRDTLTGIQRGTFADT
HGWMARLG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcggctcccttcaattcacggtgttacgtgcggtcaatccggccaccgacgcg
cagcgtgaatcgatgctgcgggagccgggtttcggcaaataccacaccgaccatatggtg
tcgatcgactatgccgagggccgtggttggcacaacgcgcgggtaatcccttatggcccg
atcgagctggatccctcggcgatcgtgctgcactatgcgcaggaggtgttcgaagggctc
aaagcctaccgctgggccgacgggtccatcgtgtcgtttcgcgccgacgccaacgccgcc
aggttgcgttcgtcggcgcggcggttggcgattcccgaactgcccgacgcggtgttcatc
gaatccctgcgccagctaatcgctgtcgacaaagcttgggtgcccggtgccggcggtgag
gaggcgctgtatctgcggccgttcatcttcgccaccgagccgggactgggcgtgcggcct
gccacccaataccgttacctgttgatcgcctcgccggccggtgcgtacttcaagggcggc
atcgcccctgtcagcgtctgggtttcgacggagtatgtacgggcctgtccgggcggcacc
ggtgcggccaagttcggcggcaactacgccgcctcgttgctggcgcaggccgaagccgcc
gagaacggatgcgaccaggtggtgtggctggacgctgtggaacgccgctatatcgaagag
atgggtggcatgaacatcttcttcgtgctcggcagcggcggatcggcgcggctggtcacc
ccggagctgtccggttccctgctgcccgggatcacacgggattcgttgttgcagttggct
attgatgccggattcgcggtcgaggaacgcaggattgatatcgacgagtggcagaagaaa
gccgccgccggcgagatcaccgaggtgtttgcgtgcggcaccgccgctgtcatcaccccg
gtcgcgcgggtgcggcacggtgccagcgagttcagaatcgccgacggtcagccgggtgag
gtgaccatggcactacgcgatacgctgaccggcatccagcggggcaccttcgcggacacc
cacggctggatggcgcggctggggtag

DBGET integrated database retrieval system