KEGG   Mycobacterium tuberculosis H37Rv: Rv2211cHelp
Entry
Rv2211c           CDS       T00015                                 

Gene name
gcvT
Definition
(RefSeq) aminomethyltransferase
  KO
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv2211c (gcvT)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2211c (gcvT)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv2211c (gcvT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv2211c (gcvT)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Rv2211c (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2476042..2477181)
Genome map
AA seq 379 aa AA seqDB search
MCQQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTA
VGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYV
SDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTE
MDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLG
ARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRG
LRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVR
GRAVECQVVCPPFVAVKTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccagcagggacgcccattagggtgggacgccgtgagcgatgtgccagagctgata
cacggaccgctggaagaccgccatcgcgagctgggtgcgagtttcgccgagttcggcggc
tggctgatgccggtctcgtatgccggaaccgtcagcgagcacaacgccacccgcaccgcc
gtcggccttttcgacgtcagccacctgggcaaggcactggtccgtggaccgggtgcggcg
cagttcgtcaactccgcgctcaccaacgacctgggtcgtatcgggcccggcaaggcgcaa
tacaccttgtgctgcaccgaatccggcggtgtgatcgacgacctgatcgcctactacgtc
agcgacgacgagatctttctggtgcccaacgccgccaataccgccgcggtggtcggcgcg
ctacaagctgccgcaccgggcggtctgagcatcaccaatctgcatcggtcctacgcggtg
ctggccgtacaggggccgtgttcgaccgacgtgctcaccgcgttggggctgccaaccgag
atggactacatgggctacgccgacgcttcgtactcgggggtgccggtgcgtgtctgtcgc
accggctacaccggtgagcacggttacgaactgctgccgccatgggagtcggcgggtgtg
gtgttcgacgcactgttggcggcggtatcagccgcgggcggcgagcccgccggcctcggt
gctcgcgacacactgcgcactgaaatgggctatccgctgcacgggcacgagctttcgctg
gacatctcgccgctgcaggcccgatgcggctgggcggtcggctggcggaaggacgccttc
tttggtcgtgcggcgttgttggccgagaaagcggccgggccgcggcggctgctgcggggg
ctgcgcatggtcggtcgcggtgtgctgcgccccgggctggctgtgcttgtcggggatgag
acggttggggtcaccacgtcgggaacgttttctcccacgttgcaggtcggcatcgggctg
gcgctgatcgacagtgatgccggcatcgaagacggccagcaaatcaatgtcgacgtccgc
ggccgtgctgtcgaatgtcaagtggtgtgtccgccgttcgttgccgtgaaaacgcgctga

DBGET integrated database retrieval system