KEGG   Mycobacterium tuberculosis H37Rv: Rv2218Help
Entry
Rv2218            CDS       T00015                                 

Gene name
lipA
Definition
(RefSeq) lipoyl synthase
  KO
K03644  
lipoyl synthase [EC:2.8.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Rv2218 (lipA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Rv2218 (lipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2485273..2486208
Genome map
AA seq 311 aa AA seqDB search
MSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCEEAGC
PNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRVADSVRTMGLRYATV
TGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHN
VETVPRIFKRIRPAFTYRRSLGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAG
CDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYE
QARNSRALASR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgctgccgagggccggcgcctgttacgcctggaggtgcgcaacgcgcagacc
ccaatcgagcgcaaaccgccgtggatcaagacacgagcccgcatcgggccggagtacacc
gagctgaagaacctggtccgccgcgaggggctgcacacggtctgcgaggaggccggctgc
cccaacatcttcgaatgctgggaggaccgagaagccaccttcctgatcggcggtgaccag
tgcacccgccgatgcgatttctgccagatcgacaccggaaagcccgccgagctggaccgc
gacgagccacgccgagtcgccgacagcgtgcgcacgatgggcctgcgctatgccaccgtc
accggcgtggctcgcgacgacctgcctgacggcggggcctggctgtacgccgcgaccgtg
cgcgccatcaaggaactcaatccgtcgaccggcgtcgaactgctgattcccgacttcaac
ggcgaaccaacccggctggccgaggtcttcgagtccggcccggaagtcctggcacacaat
gtcgaaaccgtgccccgtatcttcaagcggatccggccggcgttcacgtaccggcgcagc
ctgggtgtgcttaccgctgcgcgcgacgccggcctggtcaccaagagcaacctcatcctc
ggcctgggcgaaacctccgacgaggtgcgcaccgccctgggcgatctgcgcgacgccggc
tgcgacatcgttaccatcacccaatacctgcggccgtcggcgcgccaccatccggtcgag
cgctgggtgaagcccgaggagttcgtccagttcgcgcgattcgccgaagggctgggcttc
gccggggtattggcgggacccctggttaggtcgtcatatcgggcgggccggctctacgaa
caggcacgtaactcacgggccttggcatcccgctag

DBGET integrated database retrieval system