KEGG   Mycobacterium tuberculosis H37Rv: Rv2220Help
Entry
Rv2220            CDS       T00015                                 

Gene name
glnA1
Definition
(RefSeq) glutamine synthetase
  KO
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:mtu00001]
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2220 (glnA1)
  Energy metabolism
   00910 Nitrogen metabolism
    Rv2220 (glnA1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv2220 (glnA1)
   00220 Arginine biosynthesis
    Rv2220 (glnA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rv2220 (glnA1)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     Rv2220 (glnA1)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv2220 (glnA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2487615..2489051
Genome map
AA seq 478 aa AA seqDB search
MTEKTPDDVFKLAKDEKVEYVDVRFCDLPGIMQHFTIPASAFDKSVFDDGLAFDGSSIRG
FQSIHESDMLLLPDPETARIDPFRAAKTLNINFFVHDPFTLEPYSRDPRNIARKAENYLI
STGIADTAYFGAEAEFYIFDSVSFDSRANGSFYEVDAISGWWNTGAATEADGSPNRGYKV
RHKGGYFPVAPNDQYVDLRDKMLTNLINSGFILEKGHHEVGSGGQAEINYQFNSLLHAAD
DMQLYKYIIKNTAWQNGKTVTFMPKPLFGDNGSGMHCHQSLWKDGAPLMYDETGYAGLSD
TARHYIGGLLHHAPSLLAFTNPTVNSYKRLVPGYEAPINLVYSQRNRSACVRIPITGSNP
KAKRLEFRSPDSSGNPYLAFSAMLMAGLDGIKNKIEPQAPVDKDLYELPPEEAASIPQTP
TQLSDVIDRLEADHEYLTEGGVFTNDLIETWISFKRENEIEPVNIRPHPYEFALYYDV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
gtgacggaaaagacgcccgacgacgtcttcaaacttgccaaggacgagaaggtcgaatat
gtcgacgtccggttctgtgacctgcctggcatcatgcagcacttcacgattccggcttcg
gcctttgacaagagcgtgtttgacgacggcttggcctttgacggctcgtcgattcgcggg
ttccagtcgatccacgaatccgacatgttgcttcttcccgatcccgagacggcgcgcatc
gacccgttccgcgcggccaagacgctgaatatcaacttctttgtgcacgacccgttcacc
ctggagccgtactcccgcgacccgcgcaacatcgcccgcaaggccgagaactacctgatc
agcactggcatcgccgacaccgcatacttcggcgccgaggccgagttctacattttcgat
tcggtgagcttcgactcgcgcgccaacggctccttctacgaggtggacgccatctcgggg
tggtggaacaccggcgcggcgaccgaggccgacggcagtcccaaccggggctacaaggtc
cgccacaagggcgggtatttcccagtggcccccaacgaccaatacgtcgacctgcgcgac
aagatgctgaccaacctgatcaactccggcttcatcctggagaagggccaccacgaggtg
ggcagcggcggacaggccgagatcaactaccagttcaattcgctgctgcacgccgccgac
gacatgcagttgtacaagtacatcatcaagaacaccgcctggcagaacggcaaaacggtc
acgttcatgcccaagccgctgttcggcgacaacgggtccggcatgcactgtcatcagtcg
ctgtggaaggacggggccccgctgatgtacgacgagacgggttatgccggtctgtcggac
acggcccgtcattacatcggcggcctgttacaccacgcgccgtcgctgctggccttcacc
aacccgacggtgaactcctacaagcggctggttcccggttacgaggccccgatcaacctg
gtctatagccagcgcaaccggtcggcatgcgtgcgcatcccgatcaccggcagcaacccg
aaggccaagcggctggagttccgaagccccgactcgtcgggcaacccgtatctggcgttc
tcggccatgctgatggcaggcctggacggtatcaagaacaagatcgagccgcaggcgccc
gtcgacaaggatctctacgagctgccgccggaagaggccgcgagtatcccgcagactccg
acccagctgtcagatgtgatcgaccgtctcgaggccgaccacgaatacctcaccgaagga
ggggtgttcacaaacgacctgatcgagacgtggatcagtttcaagcgcgaaaacgagatc
gagccggtcaacatccggccgcatccctacgaattcgcgctgtactacgacgtttaa

DBGET integrated database retrieval system