KEGG   Mycobacterium tuberculosis H37Rv: Rv2225Help
Entry
Rv2225            CDS       T00015                                 

Gene name
panB
Definition
(RefSeq) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv2225 (panB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     Rv2225 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2497742..2498587
Genome map
AA seq 281 aa AA seqDB search
MSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLV
GDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATR
FLKDGGAHAVKLEGGERVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDAAEQ
TIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFS
GAKTARFVKRYADVGGELRRAAMQYAQEVAGGVFPADEHSF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcagactatctatggggccaatacccccggaggctccgggccgcggaccaag
atccgcacccaccacctacagagatggaaggccgacggccacaagtgggccatgctgacg
gcctacgactattcgacggcccggatcttcgacgaggccggcatcccggtgctgctggtc
ggtgattcggcggccaacgtcgtgtacggctacgacaccaccgtgccgatctccatcgac
gagctgatcccgctggtccgtggcgtggtgcggggtgccccgcacgcactggtcgtcgcc
gacctgccgttcggcagctacgaggcggggcccaccgccgcgttggccgccgccacccgg
ttcctcaaggacggcggcgcacatgcggtcaagctcgagggcggtgagcgggtggccgag
caaatcgcctgtctgaccgcggcgggcatcccggtgatggcacacatcggcttcaccccg
caaagcgtcaacaccttgggcggcttccgggtgcagggccgcggcgacgccgccgaacaa
accatcgccgacgcgatcgccgtcgccgaagccggagcgtttgccgtcgtgatggagatg
gtgcccgccgagttggccacccagatcaccggcaagcttaccattccgacggtcgggatc
ggcgctgggcccaactgcgacggccaggtcctggtatggcaggacatggccgggttcagc
ggcgccaagaccgcccgcttcgtcaaacggtatgccgatgtcggtggtgaactacgccgt
gctgcaatgcaatacgcccaagaggtggccggcggggtattccccgctgacgaacacagt
ttctga

DBGET integrated database retrieval system