KEGG   Mycobacterium tuberculosis H37Rv: Rv2243Help
Entry
Rv2243            CDS       T00015                                 

Gene name
fabD
Definition
(RefSeq) malonyl CoA-acyl carrier protein transacylase
  KO
K00645  
[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Fatty acid biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Rv2243 (fabD)
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Rv2243 (fabD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     Rv2243 (fabD)
Lipid biosynthesis proteins [BR:mtu01004]
 Fatty acid synthase
  Component type
   Rv2243 (fabD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2516787..2517695
Genome map
AA seq 302 aa AA seqDB search
MIALLAPGQGSQTEGMLSPWLQLPGAADQIAAWSKAADLDLARLGTTASTEEITDTAVAQ
PLIVAATLLAHQELARRCVLAGKDVIVAGHSVGEIAAYAIAGVIAADDAVALAATRGAEM
AKACATEPTGMSAVLGGDETEVLSRLEQLDLVPANRNAAGQIVAAGRLTALEKLAEDPPA
KARVRALGVAGAFHTEFMAPALDGFAAAAANIATADPTATLLSNRDGKPVTSAAAAMDTL
VSQLTQPVRWDLCTATLREHTVTAIVEFPPAGTLSGIAKRELRGVPARAVKSPADLDELA
NL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgattgcgttgctcgcacccggacagggttcgcaaaccgagggaatgttgtcgccgtgg
cttcagctgcccggcgcagcggaccagatcgcggcgtggtcgaaagccgctgatctagat
cttgcccggctgggcaccaccgcctcgaccgaggagatcaccgacaccgcggtcgcccag
ccattgatcgtcgccgcgactctgctggcccaccaggaactggcgcgccgatgcgtgctc
gccggcaaggacgtcatcgtggccggccactccgtcggcgaaatcgcggcctacgcaatc
gccggtgtgatagccgccgacgacgccgtcgcgctggccgccacccgcggcgccgagatg
gccaaggcctgcgccaccgagccgaccggcatgtctgcggtgctcggcggcgacgagacc
gaggtgctgagtcgcctcgagcagctcgacttggtcccggcaaaccgcaacgccgccggc
cagatcgtcgctgccggccggctgaccgcgttggagaagctcgccgaagacccgccggcc
aaggcgcgggtgcgtgcactgggtgtcgccggagcgttccacaccgagttcatggcgccc
gcacttgacggctttgcggcggccgcggccaacatcgcaaccgccgaccccaccgccacg
ctgctgtccaaccgcgacgggaagccggtgacatccgcggccgcggcgatggacaccctg
gtctcccagctcacccaaccggtgcgatgggacctgtgcaccgcgacgctgcgcgaacac
acagtcacggcgatcgtggagttcccccccgcgggcacgcttagcggtatcgccaaacgc
gaacttcggggggttccggcacgcgccgtcaagtcacccgcagacctggacgagctggca
aacctataa

DBGET integrated database retrieval system