KEGG   Mycobacterium tuberculosis H37Rv: Rv2281Help
Entry
Rv2281            CDS       T00015                                 

Gene name
pitB
Definition
(RefSeq) phosphate permease
  KO
K03306  
inorganic phosphate transporter, PiT family
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
2553173..2554831
Genome map
AA seq 552 aa AA seqDB search
MSDNAKHHRDGHLVASGLQDRAARTPQHEGFLGPDRPWHLSFSLLLAGSFVLFSWWAFDY
AGSGANKVILVLATVVGMFMAFNVGGNDVANSFGTSVGAGTLTMKQALLVAAIFEVSGAV
IAGGDVTETIRSGIVDLSGVSVDPRDFMNIMLSALSAAALWLLFANRMGYPVSTTHSIIG
GIVGAAIALGMVSGQGGAALRMVQWDQIGQIVVSWVLSPVLGGLVSYLLYGVIKRHILLY
NEQAERRLTEIKKERIAHRERHKAAFDRLTEIQQIAYTGALARDAVAANRKDFDPDELES
DYYRELHEIDAKTSSVDAFRALQNWVPLVAAAGSMIIVAMLLFKGFKHMHLGLTTMNNYF
IIAMVGAAVWMATFIFAKTLRGESLSRSTFLMFSWMQVFTASGFAFSHGSNDIANAIGPF
AAILDVLRTGAIEGNAAVPAAAMVTFGVALCAGLWFIGRRVIATVGHNLTTMHPASGFAA
ELSAAGVVMGATVLGLPVSSTHILIGAVLGVGIVNRSTNWGLMKPIVLAWVITLPSAAIL
ASVGLVALRAIF
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacaatgccaaacaccacagggatgggcatttggtggctagcggacttcaggat
cgcgcagcgcgcacaccgcaacacgagggcttcctcgggccggaccgaccatggcacctg
tcgttcagtctgctgctggcgggttctttcgtgctgttctcgtggtgggcattcgactac
gcagggtccggcgcgaacaaagtcatcctggtgctcgccaccgtcgtcggcatgttcatg
gccttcaacgtcggcggcaatgatgtcgccaactcgtttggcaccagcgtcggcgcgggc
acgttgaccatgaaacaggcgcttctggtcgcggcgatcttcgaggtcagcggcgcggtg
atcgccggcggcgacgtcaccgagaccatccgcagcggcatcgttgatctgtccggggtg
tccgtcgacccacgcgacttcatgaacatcatgctgtcggcgctatcggcagccgcgctc
tggctgctgtttgctaaccgtatggggtacccggtgtcgaccacacactcgatcatcggc
ggcatcgtcggcgcggcgatcgcgctggggatggtgagcggccagggcggtgccgcactc
aggatggtccagtgggatcaaatcggccagatcgtggtgtcctgggtgctgtcgccggtg
ttgggcggcttggtgtcgtacctgctctacggcgtcatcaaacggcacatcctgctgtac
aacgaacaggccgaacgacggctaacagaaattaagaaagagcgcatcgcacaccgcgag
cgccacaaggcggcgttcgaccggctcaccgagatccagcagatcgcctataccggcgcc
ctggcgcgcgacgccgtcgcggcaaaccgcaaggactttgatcccgacgaactggaatcc
gattactaccgcgagctacacgaaatcgacgccaagacatcgtcggtcgacgcgttccgg
gccctgcagaactgggttccgctggtcgccgccgccggatccatgatcattgtcgcgatg
ctgctgttcaaggggttcaagcacatgcacttgggccttaccacgatgaataactacttc
atcatcgcgatggtcggtgcagcggtgtggatggccacctttattttcgccaagacactt
cggggcgaatcactttcacggtcaacgtttttgatgttcagctggatgcaggtctttacg
gcctcgggcttcgccttcagccacggcagcaatgacattgccaacgccatcgggccgttc
gcggcaatcctggatgtgctgcgcacgggcgccattgaaggcaacgcagcggtgcctgcc
gcggccatggtaacgttcggcgtcgcgttgtgcgcggggttgtggttcattggacgacgg
gtgatcgccaccgttggacacaacctcaccacgatgcacccggcatcggggtttgctgcc
gaattgtcggccgccggggtggtcatgggagccacggtcctgggtcttccggtttccagc
acgcacattcttatcggcgccgtcctcggcgtcggcatcgtaaaccggtccaccaactgg
ggactgatgaaaccgatcgtgctagcgtgggtcatcacgctgccttcggcggcgatcctc
gcctcggtcggtcttgtcgcgctacgcgcgattttctga

DBGET integrated database retrieval system