KEGG   Mycobacterium tuberculosis H37Rv: Rv2332Help
Entry
Rv2332            CDS       T00015                                 

Gene name
mez
Definition
(RefSeq) malate oxidoreductase
  KO
K00027  
malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pyruvate metabolism
Carbon metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv2332 (mez)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rv2332 (mez)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rv2332 (mez)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     Rv2332 (mez)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
2605108..2606754
Genome map
AA seq 548 aa AA seqDB search
MSDARVPRIPAALSAPSLNRGVGFTHAQRRRLGLTGRLPSAVLTLDQQAERVWHQLQSLA
TELGRNLLLEQLHYRHEVLYFKVLADHLPELMPVVYTPTVGEAIQRFSDEYRGQRGLFLS
IDEPDEIEEAFNTLGLGPEDVDLIVCTDAEAILGIGDWGVGGIQIAVGKLALYTAGGGVD
PRRCLAVSLDVGTDNEQLLADPFYLGNRHARRRGREYDEFVSRYIETAQRLFPRAILHFE
DFGPANARKILDTYGTDYCVFNDDMQGTGAVVLAAVYSGLKVTGIPLRDQTIVVFGAGTA
GMGIADQIRDAMVADGATLEQAVSQIWPIDRPGLLFDDMDDLRDFQVPYAKNRHQLGVAV
GDRVGLSDAIKIASPTILLGCSTVYGAFTKEVVEAMTASCKHPMIFPLSNPTSRMEAIPA
DVLAWSNGRALLATGSPVAPVEFDETTYVIGQANNVLAFPGIGLGVIVAGARLITRRMLH
AAAKAIAHQANPTNPGDSLLPDVQNLRAISTTVAEAVYRAAVQDGVASRTHDDVRQAIVD
TMWLPAYD
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcccgcgtgccacggatcccggccgcgttgtccgcaccaagtctcaaccgt
ggagtcggcttcacccacgcgcagcggcggcggctggggctgaccggccggcttccgtcg
gccgtgctcacgctcgaccaacaggccgaacgcgtatggcatcagttgcagagcttggcc
accgagctgggccgcaacctgcttctcgaacagctgcactaccgccacgaggtgctgtac
ttcaaggtgctggccgaccatttgcccgaactgatgccggtggtgtacacgcccaccgtt
ggcgaggcaatccaacgcttctccgacgaataccgcgggcaacgcggactgtttctgagc
atcgacgaacccgacgaaatcgaggaagccttcaacacgttggggctggggcccgaggac
gtcgacctgatcgtgtgcaccgatgccgaggcgatcctgggtatcggtgactggggtgtg
ggtggcatccagatcgctgtgggcaaattggccctctacaccgccggcggcggcgtcgat
ccgcgccgctgcctcgcggtgtctctggatgtcggcaccgacaatgagcagctgctggcc
gatccgttctatctgggcaatcgccacgcccggcggcgcggtcgggaatacgacgagttc
gtcagtcgctatatcgaaacggctcaacggttatttccgcgtgccattctgcatttcgag
gacttcgggccggcgaacgcgcggaagatcctagacacatacggcacggattactgcgtg
ttcaacgatgacatgcaaggaaccggcgcggtggtcttggccgccgtatacagcggtctg
aaggttaccggtatcccgctgcgcgatcagacaatagtcgtcttcggcgcaggcaccgca
gggatggggatcgccgatcagatccgggacgcgatggtggcagacggtgccacgctcgag
caggcggtgtcccagatctggccgatcgacaggccgggcctgttgttcgacgacatggat
gacctgcgcgacttccaagtgccgtacgcgaaaaaccgccaccagctcggtgtggccgtc
ggggatcgggtcgggctgagcgacgcgatcaagatcgcatcgcccactatcctgctcggc
tgctcaacggtctacggagcgttcaccaaagaggtggtcgaggcgatgacggcgtcctgc
aaacacccgatgatctttccgctgtccaacccgacgtcgcgcatggaagccatccccgcc
gacgtgctggcgtggtcgaatggcagggcgctgcttgccaccggcagcccagtcgcccca
gtggaattcgacgaaaccacctacgtcatcggtcaggccaacaacgtgttggcgtttccc
ggcatcggactgggcgtcattgtcgctggtgcccggttgataaccaggcgcatgctgcat
gcagcagcgaaggccattgcgcaccaggccaatccgacaaatcccggagactcgctgttg
ccggatgtccaaaatctgcgggccatctcgacaacggtcgccgaagctgtctatcgggcc
gccgtccaagacggggtggcttccaggacgcacgacgacgtcaggcaggccatagtcgac
accatgtggctcccggcatatgactaa

DBGET integrated database retrieval system