KEGG   Mycobacterium tuberculosis H37Rv: Rv2335Help
Entry
Rv2335            CDS       T00015                                 

Gene name
cysE
Definition
(RefSeq) serine acetyltransferase
  KO
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rv2335 (cysE)
   01230 Biosynthesis of amino acids
    Rv2335 (cysE)
  Energy metabolism
   00920 Sulfur metabolism
    Rv2335 (cysE)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2335 (cysE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     Rv2335 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2609732..2610421
Genome map
AA seq 229 aa AA seqDB search
MLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGARLLARAAAEFT
RILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTIYHGVTLGGSGMVGGKRHPTV
GDRVIIGAGAKVLGPIKIGEDSRIGANAVVVKPVPPSAVVVGVPGQVIGQSQPSPGGPFD
WRLPDLVGASLDSLLTRVARLEALGGGPQAAGVIRPPEAGIWHGEDFSI
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgctgacggccatgcggggcgacatccgagcagcccgggagcgggatccggcggcccct
accgcgctggaagtcatcttctgctacccgggcgtgcacgccgtgtggggccaccgcctc
gcccactggctgtggcagcgtggcgccaggctgctcgcgcgggcagctgccgaattcact
cgcatcctgaccggtgtagatatccaccccggtgccgtcatcggtgctcgcgtgttcatc
gaccacgcgaccggcgtggtgatcggagaaaccgcggaggtcggcgacgacgtcacgatc
tatcacggcgtcactctcggcggcagtggcatggttggcgggaaacgccatcccaccgtc
ggtgaccgcgtgatcatcggcgccggggccaaggtcctcggtccgatcaagatcggcgag
gacagccggatcggcgccaatgccgtcgtggtcaagcccgtcccgccgagcgcggtggtg
gtcggggtgcccgggcaggtcatcggccaaagccagcccagtcccggcggcccgtttgat
tggaggctgcccgatctcgtgggagccagcctcgattcgctgctcaccagggtggccagg
ctggaggccctcggcggcggcccgcaagcagcaggagtcatccggccacccgaagccggg
atatggcacggcgaggacttctcgatctga

DBGET integrated database retrieval system