KEGG   Mycobacterium tuberculosis H37Rv: Rv2380cHelp
Entry
Rv2380c           CDS       T00015                                 

Gene name
mbtE
Definition
(RefSeq) peptide synthetase
  KO
K04789  
mycobactin peptide synthetase MbtE
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv2380c (mbtE)
Polyketide biosynthesis proteins [BR:mtu01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Mycobactin synthetase
    Rv2380c (mbtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2662067..2667115)
Genome map
AA seq 1682 aa AA seqDB search
MWFVQMADPSGALLNICVSYRITGDIDLARLRDAVNAVARRHRILRTTYPVGDDGVAQPT
VHADLRPGWTQYDLTDLSQRAQRLRLEVLAQREFCAPFELSRDAPLRITVVRTAADEHVL
LLVAHHIAWDDGSWRVFFTDLTQAYSRADLGADLGPEHRPSAASGPDTTEADLNYWRAIM
ADPPEPLELPGPAGTCVPTSWRAARATLRLPADTAARVATMAKNTGCTPYMVLLAAFGAL
VHRYTHSDDFLVAAPVLNRGAGTEDAIGYFGNTVAMRLRPQSAMSFRELLTATRDIASGA
FAHQRINLDRVVRELNPDRRHGAERMTRVSFGFREPDGGGFNPPGIECERYDLRSNITQL
PLGFMVEFDRAGVLVEAEHLVEILEPALAKQMLRHFGVLLDNALAAPDNTLSGLALMDER
DAARLREVSRGERFDTPVKTLVDLVNEQTTRTPDATAVVYEGQHFTYHDLNEASNRLGHW
LIEQGIGSEDRVAVLLDKSPDLIVTALGVVKSGAVYVPVDPSYPQDRLDFILADCDAKLV
LRTPVRELAGYRSDDPTDADRIRPLRPDNTAYLIYTSGTTGLPKGVAVPHRPVAEYFVWF
KGEYDVDDTDRLLQVASPSFDVSIAEIFGTLACGARMVIPRPGGLTDIGYLTALLRDEGI
TAMHFVPSLLGLFLSLPGVSQWRTLQRVPIGGEPLPGEVADKFHATFDALLHNFYGPTET
VINASRFKVVGPQGTRIVPIGRPKINTTMHLLDDSLQPVPTGVIGEIYIGGTHVAYGYHR
RAGLTAERFVADPFNPGSRMYRSGDLARRNADGDIEFVGRADEQVKIRGFRIELGDVAAA
IAVDPTVGQAVVVVSDLPRLGKSLVGYVTPAAGGDGPADVGVDLDRIRARVAAALPEYML
PAAYVVLDEIPITAHGKIDRAALPEPQIASDTEFRAPQTATERRLAQLFGELLGRDRVGA
DDSFFDLGGHSLLATKLVAAVRNAFGVDVGVREIFEFATVTALAGHIDTLDSDSARPRLT
RVDHDGPVRLSSSQMRSWFNYRFDGPNAVNNIPFAAALHGPCDTNAFAAAITDVVARHEI
LRTVYREIGGVPHQIIQPPAEVPVRCAAGSDAAWLRAELNNERGYVFDLETDWPIRAALL
STPEQTVLSLVVHHIAGDHWSAGVLFTDLLTAYRARSTGQRPSWAPLPVQYADYSVWQSA
LLDDGAGIVGPQRDYWIRQLGGLAGETGLRPDFPRPALLSGAGDAVEFRLGAAIRDKLAA
VSRDLGVTEFMLLQAAVAVVLHKAGGGVDVPIGAPVAGRSEANLDQLIGFFINIVVLRND
LRGNPTLREVLQRTRQMALAAYAHQDLPFDQVVEAVNPQRSLSRNPLFDIVVHVREQMPQ
DHVIDTGPDGDTTLRVLEPTFDAAQADLSVNFFACGDEYRGHVIYRTELYERATAQRFAD
WLVRVVEAFADRPDQPLREVEMVSAQARRRILDRSNAGAGTARVYLLDDALKPVPVGVVG
DVYYGGGPAVGARLARPSETATRFVADPFAAQPGSRLYRNGERGVWKADGQLELLAEIER
LPTAQAAPVPAEPADTETERALAAILADVLEVGEVGRYDDFFNLGGDSILATQVAARARD
GGIPLTARMVFEHPVLCELAAAVDAKPHVEAEPDDKHHAPMSTSGLSPDELSALTASWDQ
WP
NT seq 5049 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgtgcagatggccgaccccagcggtgcgttactcaacatctgtgtgtcctac
cgcatcaccggtgacatcgatctggccaggttgcgcgacgcagtcaacgccgtcgcccgt
cgccatcggatactgcgtaccacctaccctgtcggcgacgacggagtcgcccagccgacc
gtgcacgcggatcttcgccccggctggacacaatacgacctgacggacctgtcccaacgc
gcccagcggctgcgcctggaggtgttggctcagcgcgaattctgcgctcccttcgagctt
tcccgcgacgcgccattgcgaatcacggtggtgcgcacggctgccgacgaacacgtgctg
ctgttggtggcccaccacatcgcctgggatgatggttcgtggcgggtgttcttcaccgat
ctcacccaggcgtactcgcgagctgacctaggggccgatctggggccagaacaccgtccg
tcggccgcatccggacccgacactaccgaggccgacctcaactattggcgcgcgatcatg
gccgatccgccagagccgctggaacttcccggcccagccggaacgtgtgtgccgaccagt
tggcgtgccgcgcgcgccacgttgcggctgcccgccgacaccgctgcgcgggtggccacg
atggcgaagaacaccggttgcactccctacatggtgctgctggccgcgttcggtgccctg
gtgcatcgctacacccacagtgacgacttcctcgtggcggctccggtgctcaaccgtggc
gccggaaccgaagatgccatcggctatttcggcaacacggtagcgatgcggctgcgaccg
caatcggcgatgagtttccgggagttgctgaccgccacccgcgacatcgccagcggggcg
ttcgcacaccaacggatcaacctcgaccgcgtggtaagggaactgaaccccgatcgccgg
cacggtgccgagcgcatgacccgggtcagcttcggtttccgggagcccgacggcggcgga
ttcaacccgccaggcatcgagtgcgagcgctacgacctgcgcagcaacatcacgcagctg
ccgttgggcttcatggtcgaattcgaccgcgcgggtgtgctggtcgaggccgaacacctg
gtggagatcctggaacccgccctggccaagcagatgcttcgacacttcggtgtgctgctc
gacaatgcgctggccgcccccgacaacacgttgtcggggctggcgctgatggatgagcgc
gacgccgccaggctgcgcgaggtgtcgcgcggcgagcggttcgatacccctgtcaaaacc
ctcgtggacctggtgaacgagcagaccacgcggactcccgacgccaccgccgtggtgtat
gagggccaacacttcacctaccacgacctcaatgaggcgtcgaaccggttggggcactgg
ctgatcgagcaggggataggcagcgaagaccgggtcgcggtacttcttgacaaatcgccg
gacctgatcgtcacggccttgggggtggtcaagtccggggcggtgtatgtgcccgtggat
cccagctacccgcaagaccggctggatttcatcctcgccgactgcgacgcgaaactggtg
ctgcgcacgccagtacgtgagctggccggataccgcagcgacgaccccaccgacgccgat
cgaatccggccgctacggccagacaacacggcctatctcatctacacgtccggtaccacc
ggattgcccaaaggtgtcgcggtgccacaccgccccgtcgccgagtacttcgtctggttc
aagggcgaatacgacgtcgacgacaccgaccggctactgcaggtcgcctcacccagcttc
gacgtctcgatcgccgagatcttcggcacgctggcctgtggcgcgcggatggtgatacca
cgccccgggggactcaccgacattggatatctcaccgccctgttgcgcgacgagggcatc
acggcaatgcatttcgtgccgtccctactcgggctgttcctgtcgctgccgggtgtgagc
cagtggcggacgttgcagcgggtacccatcggcggggagccgctacccggtgaggtggcc
gacaagttccacgcgacattcgatgcgctgctgcacaacttctacggtccaaccgaaacc
gtgatcaacgccagccggtttaaagtggtgggcccacagggcacccgcatcgtgcccatc
ggccggcccaagatcaacaccaccatgcacctgctcgacgattcgttgcagccggtgccg
accggtgtgatcggcgagatctatattggagggacgcatgtcgcatacggataccatcgc
cgcgccgggctgaccgcggagcgattcgttgccgacccgtttaatcccggttcccgcatg
taccggtccggggatctggcgcgccgcaatgctgacggtgacatcgagttcgtgggccgt
gccgacgagcaggtcaagattcgcggattccgaatcgaactcggtgacgtagcagcggcc
atcgcggtcgaccctacggtcgggcaggccgttgtggtggttagcgacctgccgcggctg
ggcaagagtctggtgggctacgtgacacccgccgcgggcggcgacggacccgccgatgtc
ggcgtcgatctcgaccgcatccgcgcccgggtggccgcggcactgcctgaatatatgctg
cccgcggcctatgttgtgctggatgagattccgatcaccgcgcatggcaaaatcgaccgc
gccgcgctgccggaaccgcagatcgcgtcggacaccgagttccgcgcgccgcagaccgcc
accgagcggcgccttgcccaactgttcggtgagctgctcggccgcgaccgagtgggtgct
gacgactcgttcttcgacctcggcggtcactcgctgctggcaaccaaactcgttgcggcc
gtgcgcaacgcgttcggcgtcgatgtcggtgtgcgggagatcttcgaattcgccacggtg
accgcgttggccggacacatcgatacgttggattcggattcggcgaggccgcggctgacc
cgggtggatcatgacgggccagtgcgattgtcgtcgtctcaaatgcgtagctggttcaac
tatcgcttcgacgggcccaacgccgtcaacaacattcccttcgccgcggcattgcatggg
ccctgcgacaccaacgcgttcgcggcggccatcaccgatgtggtggcacgccacgagatc
ctgcgcaccgtctaccgcgagatcggcggcgtgccacaccagatcatccagccgcccgcc
gaggtgccggtgcggtgcgccgccgggtccgacgccgcgtggctgcgagccgaactgaac
aacgagcgaggttacgttttcgacctggaaaccgactggccgatccgggcggcgctgctg
agcacgccggagcagaccgtgttgtcgctggtggtgcatcacatcgccggcgaccactgg
tcggctggggtgttgttcaccgatctgctgaccgcataccgggcccgcagcaccggacaa
cggccgtcgtgggcaccgctgccggtgcagtacgccgactacagcgtgtggcagtcggcg
ctactcgacgacggtgcgggcatcgtcggtccgcaacgcgactactggatccgccagctg
gggggcctggcaggcgaaaccggtctgcgcccggacttcccgcgcccggccctgctcagc
ggtgccggtgacgcggtcgaatttcgtctcggcgccgcgatccgcgacaaattggctgcc
gtgagccgagacctcggtgtcaccgagttcatgctgctacaggccgccgtcgcggtggtg
ttacacaaggccggcggcggggtagacgtccccatcggcgccccggtggccggtcgcagc
gaggccaacctggaccagctcatcgggttcttcatcaacatcgtggtgttgcgcaacgac
ctgcgcgggaaccccacgctgcgcgaggtgctgcagcgcaccaggcagatggcgctggca
gcgtatgcacatcaggacctgccgttcgaccaggtggtggaggcggtcaacccccagcgg
tcgctgtcccgcaatccgttgttcgacattgttgtgcacgttcgcgaacaaatgccgcaa
gaccacgtcatcgacaccgggcccgacggtgacaccacgttgcgcgtgctggagccgaca
ttcgatgccgcgcaagccgatctatcggtcaacttcttcgcctgcggcgacgagtaccgc
ggccacgtcatctaccgcaccgagttgtatgagcgcgccaccgcacaacgcttcgccgac
tggctagtccgtgtcgtcgaggcgttcgccgaccgtccggaccaaccgctgcgcgaggtc
gagatggtcagcgcgcaagccagacggcgcattttggaccggtccaatgcgggcgccgga
acggcccgggtgtacctgcttgacgacgcacttaagcccgttccggtaggcgtggtgggt
gacgtttattacggtggcggtcccgccgtcggtgcccggttggcccggccatcggagacc
gcgacccgattcgttgccgatccgttcgccgcgcaaccgggttctcggctctaccgcaac
ggcgagcgcggagtgtggaaggccgacggccaactggagctgctggccgaaatcgaacgg
ctgccaacggcgcaggcggcaccggtgccggccgagcccgccgacaccgaaaccgagcgc
gcgctggctgccatcctcgccgacgtgctcgaggtgggggaggtcggacgctacgacgac
ttcttcaacctcggcggcgacagcatcctcgcgactcaggtggctgcccgggctcgagat
ggcgggataccgctgaccgcgcggatggttttcgagcatcccgttttgtgtgagctcgcc
gccgcggtcgacgccaagcctcacgtcgaggccgagccggacgacaagcatcacgcgccg
atgagcacatcagggctttccccagacgaactgtcggccctgaccgcgtcatgggaccag
tggccgtga

DBGET integrated database retrieval system