KEGG   Mycobacterium tuberculosis H37Rv: Rv2382cHelp
Entry
Rv2382c           CDS       T00015                                 

Gene name
mbtC
Definition
(RefSeq) polyketide synthetase
  KO
K04790  
mycobactin polyketide synthetase MbtC
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:mtu00001]
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv2382c (mbtC)
Lipid biosynthesis proteins [BR:mtu01004]
 Polyketide synthase
  Component type
   Rv2382c (mbtC)
Polyketide biosynthesis proteins [BR:mtu01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Mycobactin synthetase
    Rv2382c (mbtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2670269..2671603)
Genome map
AA seq 444 aa AA seqDB search
MSDNDPVVIVGLAIEAPGGVETADDYWTLLSEQREGLGPFPTDRGWALRELFDGSRRNGF
KPIHNLGGFLSSATTFDPEFFRISPREATAMDPQQRVGLRVAWRTLENSGINPDDLAGHD
VGCYVGASALEYGPALTEFSHHSGHLITGTSLGVISGRIAYTLDLAGPALTVDTSCSSAL
AAFHTAVQAIRAGDCDLALAGGVCVMGTPGYFVEFSKQHALSDDGHCRPYSAHASGTAWA
EGAAMFLLQRRSRATADRRRVLAEVRASCLNSDGLSDGLTAPSGDAQTRLLRRAIAQAAV
VPADVGMVEGHGTATRLGDRTELRSLAASYGTAPAGRGPLLGSVKSNIGHAQAAAGGLGL
VKVILAAQHAAIPPTLHVDEPSREIDWEKQGLRLADKLTPWRAVDGWRTAAVSAFGMSGT
NSHVIVSMPDTVSAPERGPECGEV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtccgataacgacccggtcgtcatcgtcgggctggccatcgaggcacccggtggtgtc
gaaaccgccgacgactactggacactgctctccgaacagcgcgagggactcggaccgttc
cccaccgatcgaggttgggcacttcgcgagctgttcgacgggtcgcgtcgaaacggattc
aaaccgatccacaaccttggcggattcctttccagcgcaactacattcgatcctgagttc
ttccgcatctcaccgcgcgaggcgacggcgatggacccgcagcagcgggtggggctgcga
gtagcatggcgcaccctggagaacagcgggatcaatcccgatgacctggccggtcacgat
gtgggctgttatgtcggtgcctcggcgctcgaatacggtcccgctttgaccgaattctcc
caccacagtggccatctgatcaccgggacgtcgctgggtgtcatctccgggcgcatcgcc
tacacccttgacctggccgggccggcgctgaccgtcgatacctcgtgttcgtcggcgctg
gcggcctttcacaccgcggttcaagctatccgggccggcgactgcgacctggcactcgcc
ggcggcgtgtgcgtgatgggtacgcccggctatttcgtcgagttctccaagcagcacgcg
ctatccgacgacggccactgccggccctacagcgcgcacgccagcggaaccgcctgggca
gagggcgccgccatgttcctcctgcagcgccggtcgcgggcaaccgctgaccggcgtcgt
gtcctcgccgaggtgcgtgccagttgcctgaactccgatggacttagcgacgggctgacc
gcgcccagcggcgacgcgcaaacgcgactgctccggcgcgccatcgcgcaggcagcagtt
gtgcccgccgatgtcgggatggtcgaagggcacggcaccgcgacccggctcggcgatcgc
accgaattgcggtcactggcagccagctacggcaccgccccggccggacgcgggccgctg
ttgggatcggtcaagtcaaacatcgggcatgctcaggcggcggcgggcgggctgggcctt
gtgaaggtcattctggccgcccagcacgccgcgatcccgccgacactgcacgtcgacgag
cccagccgcgaaatcgattgggagaaacagggtctgcggctggccgacaaactcacgccg
tggcgggccgttgacggatggcgcaccgcggcggtgtccgcgttcgggatgagcggtacc
aatagccacgtgatcgtttcgatgccggacaccgtttccgcgcccgagcgtggccccgag
tgtggggaggtgtga

DBGET integrated database retrieval system