KEGG   Mycobacterium tuberculosis H37Rv: Rv2384Help
Entry
Rv2384            CDS       T00015                                 

Gene name
mbtA
Definition
(RefSeq) 2,3-dihydroxybenzoate-AMP ligase
  KO
K04787  
mycobactin salicyl-AMP ligase [EC:6.3.2.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    Rv2384 (mbtA)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     Rv2384 (mbtA)
Polyketide biosynthesis proteins [BR:mtu01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Mycobactin synthetase
    Rv2384 (mbtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2675936..2677633
Genome map
AA seq 565 aa AA seqDB search
MPPKAADGRRPSPDGGLGGFVPFPADRAASYRAAGYWSGRTLDTVLSDAARRWPDRLAVA
DAGDRPGHGGLSYAELDQRADRAAAALHGLGITPGDRVLLQLPNGCQFAVALFALLRAGA
IPVMCLPGHRAAELGHFAAVSAATGLVVADVASGFDYRPMARELVADHPTLRHVIVDGDP
GPFVSWAQLCAQAGTGSPAPPADPGSPALLLVSGGTTGMPKLIPRTHDDYVFNATASAAL
CRLSADDVYLVVLAAGHNFPLACPGLLGAMTVGATAVFAPDPSPEAAFAAIERHGVTVTA
LVPALAKLWAQSCEWEPVTPKSLRLLQVGGSKLEPEDARRVRTALTPGLQQVFGMAEGLL
NFTRIGDPPEVVEHTQGRPLCPADELRIVNADGEPVGPGEEGELLVRGPYTLNGYFAAER
DNERCFDPDGFYRSGDLVRRRDDGNLVVTGRVKDVICRAGETIAASDLEEQLLSHPAIFS
AAAVGLPDQYLGEKICAAVVFAGAPITLAELNGYLDRRGVAAHTRPDQLVAMPALPTTPI
GKIDKRAIVRQLGIATGPVTTQRCH
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaaggcggcagatggccgccgacccagtcccgacggcggactgggtggcttt
gtaccgttccccgcggatcgggccgcgtcgtaccgggcggccggctattggtcggggcga
accctggacaccgtgctctccgatgccgcgcggcgctggcctgaccgcctcgcggtggcc
gacgccggtgatcgtcccggccacggcggcctcagttacgccgaactcgaccagcgggcc
gaccgggccgccgcggcgctgcacggcctgggcatcacgccaggcgaccgggtactgctc
cagctgccaaacggctgccagttcgcggttgccctgttcgcgttattgcgggcgggagcg
atcccagtgatgtgcctgcccggtcaccgcgccgccgaattgggccacttcgccgccgtc
agcgcggccaccgggctggtggtcgccgatgtggccagcgggttcgactatcggccgatg
gcgcgcgaacttgttgccgatcaccccaccctgcgccatgtcatcgtcgatggcgatccg
ggaccgttcgtgtcgtgggcgcagctgtgcgcccaggccggcaccggttcgccggcaccg
ccggccgatcccggatcgccagcgctgctgctggtctccggcggcaccactggcatgccc
aaactcattccacgcacccacgacgactacgtgttcaacgcgacggccagcgccgcactc
tgtcggcttagcgccgacgacgtctatctggtggtgctggccgccggccacaatttcccg
ctggcctgcccgggcctgctcggcgcgatgaccgtcggggccaccgccgtgttcgccccc
gatcccagcccggaggccgccttcgccgccatcgagcgccacggtgtcaccgtcaccgcg
ttggttccggcactggccaaactgtgggcccaatcctgtgagtgggagccggtgacaccg
aagtcactgcggttgttgcaggttggcgggtccaagctagaacccgaggacgctcgccgg
gtacgcaccgcgctcaccccgggcctgcagcaggtgttcggcatggcggaggggctgctg
aacttcacccgcatcggcgacccacccgaagtggtggagcacacccaggggcggccacta
tgcccggccgacgaactgcgcatcgtcaacgccgatggtgagccggtggggcccggggag
gaaggcgaactcttggtgcgcgggccctacacgctgaacggctattttgctgccgaacgc
gacaacgagcgctgcttcgatccggacggcttctaccgcagcggcgacctggtccgccgc
cgcgacgacggcaatctggtggtcaccgggcgcgtcaaggatgtcatctgccgtgcggga
gaaaccatcgccgccagcgacctcgaagaacagctgctgagccatccggcgatcttctcg
gccgcggcggtgggactacctgaccagtatctgggggaaaaaatctgcgctgcagtcgtt
ttcgctggagctccgattacgcttgcggagttgaacggctaccttgaccggcgtggtgtg
gccgcgcatacgcgacccgaccagctggtcgcgatgccggcgctgcccacaacgccgatc
gggaagatcgacaaacgagcgatcgtccgccagctcggcatcgcgacgggtcccgtgacg
acccagcgctgccattga

DBGET integrated database retrieval system