KEGG   Mycobacterium tuberculosis H37Rv: Rv2388cHelp
Entry
Rv2388c           CDS       T00015                                 

Gene name
hemN
Definition
(RefSeq) oxygen-independent coproporphyrinogen III oxidase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2682015..2683142)
Genome map
AA seq 375 aa AA seqDB search
MPGQPFGVYLHVPFCLTRCGYCDFNTYTPAQLGGVSPDRWLLALRAELELAAAKLDAPTV
HTVYVGGGTPSLLGGERLATLLDMVRDHFVLAPDAEVSTEANPESTWPEFFATIRAAGYT
RVSLGMQSVAPRVLATLDRVHSPGRAAAAATEAIAEGFTHVNLDLIYGTPGESDDDLVRS
VDAAVQAGVDHVSAYALVVEHGTALARRVRRGELAAPDDDVLAHRYELVDARLSAAGFAW
YEVSNWCRPGGECRHNLGYWDGGQWWGAGPGAHGYIGVTRWWNVKHPNTYAEILAGATLP
VAGFEQLGADALHTEDVLLKVRLRQGLPLARLGAAERERAEAVLADGLLDYHGDRLVLTG
RGRLLADAVVRTLLG
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcccggacaaccgttcggggtctacctgcacgtcccgttctgcctgacccgttgcggg
tactgcgacttcaatacctacaccccggcccagctgggtggcgtcagcccggaccgttgg
ctgctggcgctgcgggcggagctcgaactggcggccgccaagctggacgcaccgacggtg
cataccgtgtatgtgggtggcgggacgccatcgctgctcgggggggagcgcctggccacg
ttgctggacatggtgcgggaccactttgtgctggcgcccgacgccgaagtcagcaccgag
gccaaccccgagtcgacgtggccggagttcttcgccacgatccgcgcggccggttacacg
cgggtgtcgctcggcatgcagtcggtggccccgagggtgctggcaaccttggaccgggtg
cactcgccgggccgggcggcggccgcggccaccgaggcgatagcggagggcttcacacac
gtcaacctcgacctgatctatggaaccccgggggagtccgacgacgacctggtgcgctca
gtggacgccgcggtgcaggccggtgtggatcatgtgtccgcgtatgccttggtcgtcgag
cacggcacggcactggctcgccgggttcggcgtggtgagctggccgcgcccgatgacgac
gtgctggcgcatcgctacgagttggtcgatgctcggctgtcggcggccgggtttgcctgg
tacgaggtgtccaattggtgtcgaccgggcggcgagtgccggcacaacctgggttattgg
gacggtggccagtggtggggcgcaggtccgggcgcgcacggctacattggcgtgacacgc
tggtggaatgtcaagcaccccaacacttacgccgagatactggccggggcgacgttgccg
gtagcgggcttcgagcagctgggcgccgacgctttgcacaccgaagacgtgttgctgaag
gtccggctgcgccaggggctaccgctcgcccggctaggggctgccgaacgggaacgtgcc
gaggcggtgttggccgacggattgctggactaccacggcgaccgactggtcctcaccggc
cgggggcgattgctggccgacgcggtggtgcgcactctgctgggctaa

DBGET integrated database retrieval system