KEGG   Mycobacterium tuberculosis H37Rv: Rv2391Help
Entry
Rv2391            CDS       T00015                                 

Gene name
sirA
Definition
(RefSeq) sulfite reductase
  KO
K00392  
sulfite reductase (ferredoxin) [EC:1.8.7.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rv2391 (sirA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.1  assimilatory sulfite reductase (ferredoxin)
     Rv2391 (sirA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
2684679..2686370
Genome map
AA seq 563 aa AA seqDB search
MSAKENPQMTTARPAKARNEGQWALGHREPLNANEELKKAGNPLDVRERIENIYAKQGFD
SIDKTDLRGRFRWWGLYTQREQGYDGTWTGDDNIDKLEAKYFMMRVRCDGGALSAAALRT
LGQISTEFARDTADISDRQNVQYHWIEVENVPEIWRRLDDVGLQTTEACGDCPRVVLGSP
LAGESLDEVLDPTWAIEEIVRRYIGKPDFADLPRKYKTAISGLQDVAHEINDVAFIGVNH
PEHGPGLDLWVGGGLSTNPMLAQRVGAWVPLGEVPEVWAAVTSVFRDYGYRRLRAKARLK
FLIKDWGIAKFREVLETEYLKRPLIDGPAPEPVKHPIDHVGVQRLKNGLNAVGVAPIAGR
VSGTILTAVADLMARAGSDRIRFTPYQKLVILDIPDALLDDLIAGLDALGLQSRPSHWRR
NLMACSGIEFCKLSFAETRVRAQHLVPELERRLEDINSQLDVPITVNINGCPNSCARIQI
ADIGFKGQMIDDGHGGSVEGFQVHLGGHLGLDAGFGRKLRQHKVTSDELGDYIDRVVRNF
VKHRSEGERFAQWVIRAEEDDLR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgaaggagaacccccaaatgaccactgcacgtcccgccaaggctcgaaatgag
ggccagtgggcgctgggacatcgcgagccactcaacgccaacgaagagctgaagaaggcc
ggcaacccgctcgacgtgcgggagcgcatcgaaaacatctacgccaaacagggtttcgac
agcatcgacaagaccgacctgcgagggcgctttcgctggtggggcctgtacacccagcgt
gagcagggctacgacggcacctggaccggtgacgacaacatcgacaagctcgaggccaaa
tacttcatgatgcgggtgcgttgcgacggcggcgcgctctcggctgccgcgctgcgcacg
ctgggccagatctcgacggagttcgcgcgcgataccgccgatatctccgaccggcagaac
gtgcaataccactggatcgaagtggaaaacgtccctgaaatctggcgacggttagacgat
gtcggactgcagaccaccgaggcgtgcggtgactgcccgcgggtagtgctgggctcgccg
ttggccggcgagtcgctcgacgaagtgctcgacccgacctgggcgatcgaggagatcgtg
cgtcgctacatcggcaagcccgacttcgccgacttgccgcgcaagtacaagaccgccatc
tctggcctgcaggacgtcgcgcacgagatcaacgacgtcgccttcatcggcgtcaaccat
cccgagcacggaccaggcctggatctgtgggtgggcggtggactgtcgaccaacccgatg
ctggcccagcgggtcggcgcctgggttccactgggcgaagtgcccgaggtgtgggcggcg
gtcacctcggtgtttcgcgactacggctaccggcgactgcgcgccaaggcccggctgaaa
tttctgatcaaagactggggcatagcgaagttccgcgaagtgctcgaaaccgagtacctc
aagcgtccgctgatcgacggtccggcccccgaaccggtcaagcatccgatcgaccacgtc
ggggtgcaacgactcaagaacgggctcaacgccgtcggagtcgcccccatcgccgggcgg
gtatcgggcaccatcctcacggcggtcgccgacctgatggcgcgggccggttccgaccgg
atccggttcaccccctaccagaagctggtcatcctcgacattccggacgccttgctcgac
gacttgatcgccggtctggacgcgctggggctgcagtcgcgcccgtcgcattggcgccgg
aacttgatggcgtgcagcgggattgagttctgcaagttgtcattcgccgaaacccgggtt
cgagcacagcatttggtgcccgagctggaacgccggcttgaggacatcaactcgcagctc
gacgtaccgatcaccgtcaacatcaacggctgcccgaactcatgtgcgcgaattcaaatc
gccgacatcggattcaagggacagatgatcgacgacggacacggcggctccgtcgaaggc
ttccaggtgcatctgggcggacacctcggcctggatgccggattcggccgcaaactgcgc
cagcacaaggtcaccagtgacgaactcggcgactacatcgaccgggtggtgcgcaacttc
gtcaaacaccgcagcgaaggtgaacgcttcgcgcagtgggtcatccgggccgaggaggac
gacctgcgatga

DBGET integrated database retrieval system