KEGG   Mycobacterium tuberculosis H37Rv: Rv2392Help
Entry
Rv2392            CDS       T00015                                 

Gene name
cysH
Definition
(RefSeq) phosphoadenosine phosphosulfate reductase
  KO
K00390  
phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rv2392 (cysH)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     Rv2392 (cysH)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     Rv2392 (cysH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2686367..2687131
Genome map
AA seq 254 aa AA seqDB search
MSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAGGGVSGHRGWTTCN
YVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGTRDAIESVYDVRVLNVTPEHT
VAEQDELLGKDLFARNPHECCRLRKVVPLGKTLRGYSAWVTGLRRVDAPTRANAPLVSFD
ETFKLVKVNPLAAWTDQDVQEYIADNDVLVNPLVREGYPSIGCAPCTAKPAEGADPRSGR
WQGLAKTECGLHAS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagacaaccaggctgaccgaaccgcaactacgtgagctggccgcgcgcgga
gctgccgaactcgacggcgccaccgccaccgacatgttgcgctggaccgacgaaaccttc
ggcgacatcggcggcgccggcggcggcgtgagcggacatcgcgggtggacaacgtgcaac
tacgtagttgcttccaacatggctgatgcggtgctggtggatctggccgccaaggtgcga
ccgggcgtaccggtcatctttcttgataccggctaccacttcgtcgaaacaatcggcacc
agagatgcgatcgagtccgtctatgacgtccgggtgctcaatgtcactccggagcacaca
gtggccgagcaggacgaactgctgggcaaggacttgttcgcccgcaacccccatgaatgc
tgccggttgcgcaaggtcgttcccctgggcaagacgctgcgtggctactccgcgtgggtg
accgggctacggcgggtcgatgcaccgacccgggccaatgccccgctggtcagcttcgat
gagacgttcaaactagtgaaggtcaacccgctggcggcgtggaccgaccaagatgtgcag
gaatacattgccgacaacgacgtgctggttaatccgcttgtgcgggaaggctatccgtcg
atcggttgcgctccgtgcacagccaaacccgccgaaggcgccgacccgcgcagcggacgc
tggcaggggctggccaagaccgaatgcgggttgcacgcctcgtga

DBGET integrated database retrieval system