KEGG   Mycobacterium tuberculosis H37Rv: Rv2397cHelp
Entry
Rv2397c           CDS       T00015                                 

Gene name
cysA1
Definition
(RefSeq) sulfate ABC transporter ATP-binding protein CysA
  KO
K02045  
sulfate transport system ATP-binding protein [EC:3.6.3.25]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Sulfur metabolism
ABC transporters
Module
Sulfate transport system
Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rv2397c (cysA1)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rv2397c (cysA1)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.25  sulfate-transporting ATPase
     Rv2397c (cysA1)
Transporters [BR:mtu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfate transporter [MD:M00185] [OT]
    Rv2397c (cysA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2693909..2694964)
Genome map
AA seq 351 aa AA seqDB search
MTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGT
ITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNLLQ
VVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLRRL
HDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST
LNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGA
FTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgccatcgtcgtggccgacgccaccaaacgctacggcgacttcgtcgcactt
gaccacgtggatttcgtcgtaccgaccggttcgctgaccgcattgttgggccccagcggt
tcgggcaagtcgacgctgttgcgcaccatagccggcctcgaccaaccggacaccggaacc
atcacgatcaacggccgcgacgtcacccgggtgccgccacagcggcgtggcatcggattc
gtcttccagcactacgcggcgttcaaacacctgactgtccgtgacaacgtggcgttcggg
ttgaagatccgtaagcgccccaaggccgagatcaaggccaaggtcgacaatctgctgcag
gtggtgggcctgagcggatttcagagccgctaccccaatcagctctccggtgggcaacga
cagcggatggcgctggccagggcgctggcggtcgatccggaggtgctgctgctcgacgag
ccgttcggcgcactcgatgccaaggtgcgcgaagagctgcgtgcctggctgcgccgcctg
cacgacgaggtgcatgtcaccacggtgctggtcacccacgatcaggccgaagcgctggat
gtggccgaccgcatcgccgtactccacaagggccgtatcgagcaggtcggatccccgacc
gacgtttacgacgccccggcgaacgccttcgtgatgtccttcttgggagcggtttccacg
ttgaacggctccctggtgcgcccgcacgacatccgggtcggccggactcccaatatggcc
gtggccgccgctgacggcaccgccgggtccaccggtgtgctacgggctgttgtggatcgg
gtggtggtgctgggcttcgaggtccgcgtggagttgaccagcgcggccaccggcggggcc
ttcaccgcccagatcacccgcggcgatgccgaggcgctggccctacgcgagggtgacacc
gtctacgtgcgtgccacccgggtgccgccgattgccggtggcgtatcgggcgtcgacgat
gccggcgtggaacgggtcaaagtcacatcgacgtga

DBGET integrated database retrieval system