KEGG   Mycobacterium tuberculosis H37Rv: Rv2421cHelp
Entry
Rv2421c           CDS       T00015                                 

Gene name
nadD
Definition
(RefSeq) nicotinate-nucleotide adenylyltransferase
  KO
K00969  
nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Module
NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv2421c (nadD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     Rv2421c (nadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2718173..2718808)
Genome map
AA seq 211 aa AA seqDB search
MGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRYLMTVIATASN
PRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELAR
FVGVSRPGYELRNEHITSLLGQLAKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDG
VVQYVSKCRLYCGACDAGARSTTSLAAGNGL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggacgttcgaccccatccactacggccacctggttgccgccagcgaggtggcc
gacctgttcgatctcgacgaagtggtattcgtgcccagcgggcaaccctggcaaaagggt
cgacaggtctccgccgccgagcaccgctacctaatgacggtgatcgccaccgcctccaat
ccccgattctctgtgagccgggtcgacatcgaccgcggcggacccacctacaccaaggac
acgctggccgatctgcatgctttgcacccggactctgagctgtacttcaccaccggcgcc
gatgcgctagcttccataatgtcctggcagggctgggaggagctgttcgaattggcgcgg
ttcgtgggggtcagccggcccggctacgagttgcgcaacgaacacatcactagcctgctg
ggtcagctggccaaggatgcgttgactctggtcgagatcccggcgctggccatttcgtcg
accgactgccgtcagcgcgccgagcagtcccggccgctgtggtacctgatgcccgacggc
gtcgtgcagtatgtctccaagtgccggctctactgtggcgcctgcgacgcgggcgcgcgt
tcaacgaccagcctggccgctgggaatggcctatga

DBGET integrated database retrieval system