KEGG   Mycobacterium tuberculosis H37Rv: Rv2439cHelp
Entry
Rv2439c           CDS       T00015                                 

Gene name
proB
Definition
(RefSeq) glutamate 5-kinase protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00330  Arginine and proline metabolism
mtu00332  Carbapenem biosynthesis
mtu01100  Metabolic pathways
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rv2439c (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Rv2439c (proB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Rv2439c (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 885266
NCBI-ProteinID: NP_216955
TubercuList: Rv2439c
UniProt: P9WHU9 I6YDE7
Position
complement(2737117..2738247)
Genome map
AA seq 376 aa AA seqDB search
MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAVERRMKAGSDVVIVSSGA
IAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLTAHDISMRV
QHTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGADALVLLSDID
GLYDCDPRKTADATFIPEVSGPADLDGVVAGRSSHLGTGGMASKVAAALLAADAGVPVLL
APAADAATALADASVGTVFAARPARLSARRFWVRYAAEATGALTLDAGAVRAVVRQRRSL
LAAGITAVSGRFCGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSELPGELRRPVV
HADDLVAVSAKQAKQV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtccgcatcgggacgcaatccggaccgcgcgcggccttgtcgtgaaggtcggg
accacggcgcttaccacaccgtccgggatgttcgatgccggccggctggccggactggcc
gaggcggtcgagcggcggatgaaggcgggttccgacgtcgtcatcgtgtcttcgggcgcc
atcgccgccggcatcgagccgctcgggctgtcccgtcgtcccaaagatctggcgaccaag
caggcggcggccagcgtcgggcaggtcgcgctggtgaactcgtggagcgcggcgttcgcc
cgctacggccgcacggtgggccaggtgctgctgaccgcgcacgacatttcgatgcgggtg
cagcacaccaacgcccaacgcacgctggatcggctgcgcgcgttgcacgcggtggcgatt
gtcaacgagaacgacaccgtggccaccaacgagatccggttcggtgacaacgatcggctg
tctgcactggtggcgcacctggtcggcgccgacgctttggtgctgctgtcggacatcgac
ggcctctacgactgcgacccgcgcaaaaccgcggacgcgacgttcattccggaggtgtcc
gggccggcggatctggacggtgtggtcgccggccgcagtagccacctgggtactggcggc
atggcgtccaaggtggcggcggcgctgttggccgccgacgccggggtgccggtactgctg
gcccccgcggccgacgccgcgaccgcgctcgccgacgcgtcggtgggcacggtgtttgcg
gcccggcccgcgcgtctgtcggcccggcggttctgggtgcgttatgccgccgaagcaacc
ggcgcactgactctcgacgccggtgcggtgcgcgctgtggtgcgacaacgccggtcactg
ctggcggcgggtatcaccgcggtgtccggccggttttgcggcggcgatgtggtcgaactg
cgtgcacccgacgcggccatggtagcccgcggggtggttgcctacgacgcgtccgagctg
gccaccatggtgggccggtccacctctgagctacccggcgagctgcgccgcccggtggtg
cacgccgacgatctggtcgcggtgtcggcgaagcaagctaagcaagtttag

DBGET integrated database retrieval system