KEGG   Mycobacterium tuberculosis H37Rv: Rv2445cHelp
Entry
Rv2445c           CDS       T00015                                 

Gene name
ndkA
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00230  Purine metabolism
mtu00240  Pyrimidine metabolism
mtu00983  Drug metabolism - other enzymes
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
Module
mtu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mtu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mtu_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv2445c (ndkA)
   00240 Pyrimidine metabolism
    Rv2445c (ndkA)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Rv2445c (ndkA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Rv2445c (ndkA)
Membrane trafficking [BR:mtu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Rv2445c (ndkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK TruB_C
Motif
Other DBs
NCBI-GeneID: 885905
NCBI-ProteinID: NP_216961
TubercuList: Rv2445c
UniProt: P9WJH7 I6X4A3
Structure
PDB: 

Jmol
Position
complement(2745314..2745724)
Genome map
AA seq 136 aa AA seqDB search
MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFG
SLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSD
SAESAQREIALWFPGA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacggactctggtactgatcaagccggatggcatcgaaaggcagctgatcggc
gagatcatcagccgcatcgagcgcaaaggcctcaccatcgctgcgctgcagctcaggacc
gtcagcgcggagttggccagccagcactacgccgaacatgaaggcaaaccattctttgga
tcgttgctggagttcatcacgtcgggtccggtggtagcggcgatcgtggagggaacccga
gccatcgcggcggttcgccaactcgccggcggcaccgacccggtgcaggcggcggcgccc
ggcacaatccggggcgacttcgctctagagacgcagttcaacctggtgcacgggtctgat
tcggccgaatccgcgcagcgcgaaatcgcgctctggtttcccggcgcctag

DBGET integrated database retrieval system