KEGG   Mycobacterium tuberculosis H37Rv: Rv2445cHelp
Entry
Rv2445c           CDS       T00015                                 

Gene name
ndkA
Definition
(RefSeq) nucleoside diphosphate kinase
  KO
K00940  
nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rv2445c (ndkA)
   00240 Pyrimidine metabolism
    Rv2445c (ndkA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Rv2445c (ndkA)
Membrane trafficking [BR:mtu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Rv2445c (ndkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2745314..2745724)
Genome map
AA seq 136 aa AA seqDB search
MTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFG
SLLEFITSGPVVAAIVEGTRAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSD
SAESAQREIALWFPGA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacggactctggtactgatcaagccggatggcatcgaaaggcagctgatcggc
gagatcatcagccgcatcgagcgcaaaggcctcaccatcgctgcgctgcagctcaggacc
gtcagcgcggagttggccagccagcactacgccgaacatgaaggcaaaccattctttgga
tcgttgctggagttcatcacgtcgggtccggtggtagcggcgatcgtggagggaacccga
gccatcgcggcggttcgccaactcgccggcggcaccgacccggtgcaggcggcggcgccc
ggcacaatccggggcgacttcgctctagagacgcagttcaacctggtgcacgggtctgat
tcggccgaatccgcgcagcgcgaaatcgcgctctggtttcccggcgcctag

DBGET integrated database retrieval system