KEGG   Mycobacterium tuberculosis H37Rv: Rv2458Help
Entry
Rv2458            CDS       T00015                                 

Gene name
mmuM
Definition
(RefSeq) homocysteine S-methyltransferase MmuM
  KO
K00547  
homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2458 (mmuM)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     Rv2458 (mmuM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2759779..2760687
Genome map
AA seq 302 aa AA seqDB search
MELVSDSVLISDGGLATELEARGHDLSDPLWSARLLVDAPHAITAVHTAYFRAGAQIATT
ASYQASFEGFAARGIGHDDATVLLRRSVELAQAARDEVGVGGLSVAASVGPYGAALADGS
EYRGYYGLSVAALMKWHLPRLEVLVDAGADMLALETIPDIDEAEALVNLVRRLATPAWLS
YTINGTRTRAGQPLTDAFAVAAGVPEIVAVGVNCCAPDDVLPAIAFAVAHTGKPVIVYPN
SGEGWDGRRRAWVGPRRFSGSSGQLAREWVAAGARIVGGCCRVRPIDIAEIGRALTTAPP
RG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtcagcgattccgtgctgatcagcgatggcggcctggccaccgagcttgag
gcgcgcggtcacgacctgtccgacccgttgtggtcggcgcggctgctggtggacgctccg
cacgcgatcaccgcggtgcataccgcgtactttcgcgctggggcccagattgccacgact
gccagctaccaggcctcgttcgagggcttcgcggcgcgcggcataggtcatgacgacgcc
accgtgctgctgcgccgcagcgtcgaactcgcccaggctgcgcgcgacgaggtcggcgtt
ggcggtctatcggtcgcagcctcggtcgggccatacggcgccgcgctggctgacggatcc
gaataccgcggatactacggcctgtccgtcgcagccttgatgaagtggcatctgccacgg
ctcgaggtgctagtcgatgccggcgctgacatgctcgccctggaaaccatccccgatatc
gacgaagccgaagcgctggtcaacctggtgcggcggttggctacgccggcctggctcagc
tacacgatcaacgggacgcggactcgcgccgggcaaccgctcaccgacgcgtttgcggtg
gccgcaggagttcccgagatcgtcgccgtcggcgtcaactgctgcgcacccgacgacgtg
ttgccggccatcgctttcgccgtcgcccacacaggcaaaccggtgatcgtgtacccgaac
agcggtgagggttgggatggtcggcgccgcgcctgggtaggtccgcggcggttttccgga
tcttccgggcagcttgcgcgggaatgggttgcggcgggcgcgcgcatcgtgggcggatgc
tgccgagtacggccgatcgatattgccgaaatcgggcgagcgctgaccaccgcgccgccc
cgaggctga

DBGET integrated database retrieval system