KEGG   Mycobacterium tuberculosis H37Rv: Rv2465cHelp
Entry
Rv2465c           CDS       T00015                                 

Gene name
rpiB
Definition
(RefSeq) ribose-5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu00051  Fructose and mannose metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv2465c (rpiB)
   00051 Fructose and mannose metabolism
    Rv2465c (rpiB)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Rv2465c (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB PhnG
Motif
Other DBs
NCBI-GeneID: 887225
NCBI-ProteinID: YP_177884
TubercuList: Rv2465c
UniProt: P9WKD7
Structure
PDB: 

Jmol
Position
complement(2767671..2768159)
Genome map
AA seq 162 aa AA seqDB search
MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVAD
PGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEA
LAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcatgcgcgtctacctgggggccgaccacgccggatatgagctcaagcagcgg
atcatcgagcacctgaagcaaaccggccacgagccgatcgactgcggcgcgttgcgctac
gacgccgacgacgactacccggcattctgcattgccgcagcgacgcgcactgtcgccgat
ccgggcagcctgggcatcgtgctgggcggatcgggcaacggggagcagatcgccgccaac
aaggtgcccggcgctcgctgcgcgctggcctggagtgtgcagaccgcggcgctggctcgc
gagcacaacaacgcccaattgatcggcatcggcggccgcatgcacacggtggccgaggca
ctggcgatagtcgacgccttcgtcaccacgccgtggtcgaaagcgcaacgccaccaacgg
cgtatcgacattctcgccgagtacgaacggacccacgaagcgccgccggtgcccggcgct
ccggcctga

DBGET integrated database retrieval system