KEGG   Mycobacterium tuberculosis H37Rv: Rv2465cHelp
Entry
Rv2465c           CDS       T00015                                 

Gene name
rpiB
Definition
(RefSeq) ribose-5-phosphate isomerase B
  KO
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv2465c (rpiB)
   00051 Fructose and mannose metabolism
    Rv2465c (rpiB)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     Rv2465c (rpiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(2767671..2768159)
Genome map
AA seq 162 aa AA seqDB search
MSGMRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDDYPAFCIAAATRTVAD
PGSLGIVLGGSGNGEQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEA
LAIVDAFVTTPWSKAQRHQRRIDILAEYERTHEAPPVPGAPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcatgcgcgtctacctgggggccgaccacgccggatatgagctcaagcagcgg
atcatcgagcacctgaagcaaaccggccacgagccgatcgactgcggcgcgttgcgctac
gacgccgacgacgactacccggcattctgcattgccgcagcgacgcgcactgtcgccgat
ccgggcagcctgggcatcgtgctgggcggatcgggcaacggggagcagatcgccgccaac
aaggtgcccggcgctcgctgcgcgctggcctggagtgtgcagaccgcggcgctggctcgc
gagcacaacaacgcccaattgatcggcatcggcggccgcatgcacacggtggccgaggca
ctggcgatagtcgacgccttcgtcaccacgccgtggtcgaaagcgcaacgccaccaacgg
cgtatcgacattctcgccgagtacgaacggacccacgaagcgccgccggtgcccggcgct
ccggcctga

DBGET integrated database retrieval system