KEGG   Mycobacterium tuberculosis H37Rv: Rv2471Help
Entry
Rv2471            CDS       T00015                                 

Gene name
aglA
Definition
(RefSeq) alpha-glucosidase AglA
  KO
K01187  
alpha-glucosidase [EC:3.2.1.20]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rv2471 (aglA)
   00500 Starch and sucrose metabolism
    Rv2471 (aglA)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Rv2471 (aglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
2773564..2775204
Genome map
AA seq 546 aa AA seqDB search
MDQHQRPDPMGPGSPRASARRPEPDPMGEPWWSRAVFYQVYPRSFADSNGDGVGDLDGLA
SRLDHLQQLGVDAIWINPVTVSPMADHGYDVADPRDIDPLFGGMPAFERLVAAAHRQGIK
VTMDVVPNHTSSAHPWFQAALADLPGSPARDRYFFRDGRGPDGSLPPNNWESVFGGPAWT
RVREPDGNPGQWYLHLFDTEQPDLNWDNPEILDDFEKTLRFWLDRGVDGFRIDVAHGMAK
PPGLPDSPDLGIEVLHHRDDDPRFNHPNVHAIHRDIRTVIDEYPGAVTVGEVWVHDNARW
AEYLRPDELHLGFNFRLARTEFDAAEIRDAVANSLAAAALQNATPTWTLANHDVGREVSR
YGGGEIGLRRAKAMAVVMLALPGVVFLYNGQELGLPDVDLPDEVLQDPTWERSGRTERGR
DGCRVPIPWSGNIPPFGFSTCPDTWLPMPPEWAALTAEKQRADAGSTLSFFRLALRLRRE
RNEFDGDVDWLAAPDDALIFRRHGGGLVCALNAAERPLALPAGEPILASAPLTDATLPPN
AAAWLV
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggaccaacaccagcgaccggatccaatgggccccggctctcctcgcgccagcgctcgt
cgaccggagccagatccgatgggcgagccgtggtggtcgcgagccgtgttctaccaggtc
tatccccgatcgttcgccgacagcaacggcgacggggtgggcgacctggacgggttggcg
agccggcttgaccacctgcaacagctcggtgtcgacgcgatctggatcaacccggtcacc
gtctcgccgatggcagaccacggatacgacgtcgccgatccccgcgacatcgacccactc
ttcggcgggatgccggcgttcgaacggttggtcgctgcggcacaccggcagggcatcaaa
gtcaccatggacgtggtgcccaaccacaccagttcggcgcacccatggtttcaggccgcg
ctggctgacctcccgggtagcccggcgcgggatcgctatttctttcgcgacgggcggggc
cccgacgggtcgctgccgccgaacaactgggagtcggtgttcggcgggccggcctggacc
cgagtgcgcgaaccggacggcaacccgggccagtggtacctgcaccttttcgacaccgaa
cagccggacctgaactgggacaacccggaaatccttgacgacttcgagaaaacactgcgc
ttctggctggaccgcggcgtggatggcttccgcatcgacgtggcgcacggcatggccaag
cccccgggcctgccggactcaccggacctgggcatcgaggtgctgcaccaccgcgatgac
gacccgcgcttcaaccacccgaatgtgcacgcgattcaccgcgacatccgcacggtgatc
gacgagtaccccggagcggtaaccgtcggcgaggtgtgggtacacgacaacgcccgctgg
gcggagtatctgcggcccgacgaactgcatctcggcttcaatttccggctggcgcgaacc
gagttcgacgccgccgagatccgcgacgcggtggcgaactccctggccgccgcggcgctg
cagaacgcgaccccaacctggacgctggccaatcacgatgtgggacgggaggttagccgc
tacggcggcggcgagatcgggctgcgccgggccaaggcgatggcggtggtgatgctcgcc
ctgccgggcgtggtcttcctctacaacggccaggaactgggtttgcccgacgtggacctg
cccgacgaggtgctgcaggatccgacgtgggaacgctcgggacgcaccgaacgcggtcgc
gatggctgccgggtgccgattccctggtcgggcaacattcccccgttcgggttctcgacg
tgtccagacacctggttgccgatgccgccggaatgggcggcgctgaccgccgaaaaacaa
cgcgctgatgccggctcgaccttgtcgttttttcgacttgcactcagattacgtagggaa
cgaaatgaattcgacggcgacgtcgactggctggccgcgcccgacgatgcgctgatattc
cggcgtcacggcgggggtttggtgtgcgcgctcaacgccgctgagcgtccgctggcgctg
ccggcaggtgaacccatcctggccagcgcaccgttgaccgacgccacgttgccacccaat
gccgcggcctggctggtgtag

DBGET integrated database retrieval system