KEGG   Mycobacterium tuberculosis H37Rv: Rv2476cHelp
Entry
Rv2476c           CDS       T00015                                 

Gene name
gdh
Definition
(RefSeq) NAD-dependent glutamate dehydrogenase
  KO
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rv2476c (gdh)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv2476c (gdh)
   00220 Arginine biosynthesis
    Rv2476c (gdh)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Rv2476c (gdh)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     Rv2476c (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
TubercuList: 
UniProt: 
Position
complement(2777388..2782262)
Genome map
AA seq 1624 aa AA seqDB search
MTIDPGAKQDVEAWTTFTASADIPDWISKAYIDSYRGPRDDSSEATKAAEASWLPASLLT
PAMLGAHYRLGRHRAAGESCVAVYRADDPAGFGPALQVVAEHGGMLMDSVTVLLHRLGIA
YAAILTPVFDVHRSPTGELLRIEPKAEGTSPHLGEAWMHVALSPAVDHKGLAEVERLLPK
VLADVQRVATDATALIATLSELAGEVESNAGGRFSAPDRQDVGELLRWLGDGNFLLLGYQ
RCRVADGMVYGEGSSGMGVLRGRTGSRPRLTDDDKLLVLAQARVGSYLRYGAYPYAIAVR
EYVDGSVVEHRFVGLFSVAAMNADVLEIPTISRRVREALAMAESDPSHPGQLLLDVIQTV
PRPELFTLSAQRLLTMARAVVDLGSQRQALLFLRADRLQYFVSCLVYMPRDRYTTAVRMQ
FEDILVREFGGTRLEFTARVSESPWALMHFMVRLPEVGVAGEGAAAPPVDVSEANRIRIQ
GLLTEAARTWADRLIGAAAAAGSVGQADAMHYAAAFSEAYKQAVTPADAIGDIAVITELT
DDSVKLVFSERDEQGVAQLTWFLGGRTASLSQLLPMLQSMGVVVLEERPFSVTRPDGLPV
WIYQFKISPHPTIPLAPTVAERAATAHRFAEAVTAIWHGRVEIDRFNELVMRAGLTWQQV
VLLRAYAKYLRQAGFPYSQSYIESVLNEHPATVRSLVDLFEALFVPVPSGSASNRDAQAA
AAAVAADIDALVSLDTDRILRAFASLVQATLRTNYFVTRQGSARCRDVLALKLNAQLIDE
LPLPRPRYEIFVYSPRVEGVHLRFGPVARGGLRWSDRRDDFRTEILGLVKAQAVKNAVIV
PVGAKGGFVVKRPPLPTGDPAADRDATRAEGVACYQLFISGLLDVTDNVDHATASVNPPP
EVVRRDGDDAYLVVAADKGTATFSDIANDVAKSYGFWLGDAFASGGSVGYDHKAMGITAR
GAWEAVKRHFREIGIDTQTQDFTVVGIGDMSGDVFGNGMLLSKHIRLIAAFDHRHIFLDP
NPDAAVSWAERRRMFELPRSSWSDYDRSLISEGGGVYSREQKAIPLSAQVRAVLGIDGSV
DGGAAEMAPPNLIRAILRAPVDLLFNGGIGTYIKAESESDADVGDRANDPVRVNANQVRA
KVIGEGGNLGVTALGRVEFDLSGGRINTDALDNSAGVDCSDHEVNIKILIDSLVSAGTVK
ADERTQLLESMTDEVAQLVLADNEDQNDLMGTSRANAASLLPVHAMQIKYLVAERGVNRE
LEALPSEKEIARRSEAGIGLTSPELATLMAHVKLGLKEEVLATELPDQDVFASRLPRYFP
TALRERFTPEIRSHQLRREIVTTMLINDLVDTAGITYAFRIAEDVGVTPIDAVRTYVATD
AIFGVGHIWRRIRAANLPIALSDRLTLDTRRLIDRAGRWLLNYRPQPLAVGAEINRFAAM
VKALTPRMSEWLRGDDKAIVEKTAAEFASQGVPEDLAYRVSTGLYRYSLLDIIDIADIAD
IDAAEVADTYFALMDRLGTDGLLTAVSQLPRHDRWHSLARLAIRDDIYGALRSLCFDVLA
VGEPGESSEQKIAEWEHLSASRVARARRTLDDIRASGQKDLATLSVAARQIRRMTRTSGR
GISG
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatcccggggctaagcaggatgttgaggcgtggaccacgttcaccgcgagt
gcggacattcctgactggatctcgaaggcctacatcgacagctatcgaggaccgcgcgac
gactcgtcggaagccaccaaggccgccgaggccagttggcttccagcctccctgctgacg
cccgccatgctgggcgcacattatcggcttggccggcaccgcgcggccggtgaaagctgt
gtcgccgtctatcgggcggacgatcccgcggggttcggtccggcgctgcaggtggtcgcc
gagcacggcggcatgctgatggattccgttacggtgctgctgcaccggcttggaatcgcc
tacgcggcgattctgaccccggtgttcgacgtgcaccgcagccccacgggagagctgctg
cgcatcgaaccgaaggccgagggcacgtcgccgcacctgggtgaggcctggatgcacgta
gcgctctcgcccgccgttgatcacaaaggcctcgccgaggtggagcggttgctgcccaag
gtgctggccgacgtccagcgggtggccaccgacgccacagcgctgatcgccaccctgagc
gagctggcgggagaagtcgaatccaatgccggcggccgattttccgcgcccgaccgacaa
gacgtcggggaactgttgcgttggctgggtgacgggaacttcctgctgctgggctaccaa
cggtgccgggtggctgacgggatggtctacggcgaggggtcaagcggtatgggcgtcctg
cggggccgcaccggttcgcgtccccggctgaccgacgacgacaaactgctggtgttggcc
caagcgcgggtcggcagctacctgcgttacggcgcctatccctatgccatcgcggtccgc
gaatacgtcgacggcagcgtggtcgagcaccgcttcgtcgggctcttcagcgtcgcggcc
atgaatgcggacgtgctggagatcccgacgatctcgcgccgggtccgcgaggcgctggcg
atggccgaaagcgatcccagccacccaggccaattgctgctcgacgtcatccagaccgtc
ccgcgaccggagctgttcaccctgagcgcgcagcgcctgctgaccatggccagggccgtg
gtggacttgggatcgcaacggcaggcgttgttgttcctgcgcgcggatcggttgcagtac
ttcgtgtcgtgcctggtctacatgccccgagatcgctacaccaccgccgtgcgcatgcaa
ttcgaggacatccttgtccgcgagttcgggggaacacgactggagttcaccgctcgggtc
agtgaatcaccttgggcactcatgcatttcatggtgcggctacccgaagtgggtgtggca
ggagaaggggcggccgccccgccggtggacgtttccgaagccaaccggatccggatccag
ggtctgctgaccgaagccgcgcgaacctgggccgaccgtttgatcggcgcggcggcggcg
gctggctccgtcggacaggccgacgctatgcattacgctgccgccttctccgaggcctac
aaacaggccgtcaccccggccgatgccattggcgacattgcggtcatcacggagctgacc
gacgattcggtcaagctggtgttttccgaacgcgacgagcagggtgtcgcccagttgacc
tggttcctcggtgggcgcaccgcttcgctgagccagctgctgccgatgctgcaaagcatg
ggagtcgtggtgctcgaagagcgaccgttctccgtcacccggccggacggtctgccggtc
tggatctatcagttcaagatctcgccgcatcccacgatcccgttggccccgacggttgcc
gagcgggccgcgaccgcgcaccgattcgccgaggcggtgaccgcgatctggcacggccgg
gtcgaaatcgaccgattcaacgagctggtgatgcgtgccgggctgacttggcagcaggtc
gtgctgctccgtgcctacgcgaagtacctgcgccaggcgggcttcccgtacagccagtcc
tacattgaatcggtgctcaacgagcaccctgctaccgttcggtctttggtcgatctgttc
gaagcgcttttcgttccggtgccgtcggggtcggcgagcaatcgcgatgcccaagcggcc
gctgccgctgtcgccgcggacatcgacgcgctggtgagcctggacaccgaccggatcctg
cgcgccttcgcgtcgttggttcaggccacgttgcgcaccaattactttgtgacacgccag
ggttcggcccgctgccgtgatgtattggcgctgaaactcaatgcccagttgatcgacgaa
cttccgctgccgcgtccccggtacgagatttttgtgtattcgccccgcgtcgaaggcgtg
catctgaggttcggcccagttgcgcgtggcgggttgcgctggtcggaccgccgtgacgat
ttccgaaccgagattctcggattggtcaaggcgcaagcggtgaagaacgccgtcatcgtg
ccggtcggggccaagggcgggttcgtggtcaagcgtcccccgctgcccaccggcgacccc
gccgccgaccgcgacgccacccgcgccgaaggggtcgcctgctatcagctgttcatctcc
gggttgctcgatgtcaccgacaacgtcgatcatgcgaccgcaagcgtcaaccccccgccc
gaggtggtgcgacgtgacggcgacgacgcctacttggtagtggccgccgacaaaggtact
gccaccttttccgatatcgccaacgatgtcgccaagtcctatgggttctggctgggcgac
gcgttcgcctcgggcggatcggtgggctacgaccacaaggccatgggcatcaccgcccgg
ggggcctgggaggccgtaaaacggcatttccgagagatcgggatcgacacccagacccag
gatttcaccgtcgtgggaatcggcgacatgagcggcgacgtattcggcaacggcatgttg
ctgagcaagcacatccggctgatcgccgccttcgaccaccgccacatcttcctcgacccc
aaccccgatgccgcggtgtcgtgggccgaacgccggcggatgttcgagttgccccggtcc
agctggagcgactatgacaggtctctgatcagcgagggcggcggggtgtacagccgcgaa
cagaaagccatcccgctcagcgcgcaggtccgcgccgtcctcggcatcgacggctcagtt
gacgggggggccgccgagatggccccgcccaaccttattcgggcgattctgcgggcgccg
gtggacctgctgttcaacggcggcatcggcacttacatcaaggccgagtcagagtcggat
gctgatgtcggcgatcgcgccaacgatccggtgcgagtcaacgcgaatcaagtgcgcgcc
aaggtcattggcgaaggtggcaatctcggagtgacggcgttgggccgtgtcgaattcgat
ctgtccggcggccggatcaacaccgacgcgctggacaactccgccggcgtggactgctcg
gaccacgaggtcaacatcaagatcctgatcgactcgctggtgagcgccggcacggtcaaa
gccgacgaacgcacacagctgctcgagtcaatgaccgacgaggtagcgcaactggtgctc
gccgacaacgaagatcagaacgacttgatgggcaccagtcgcgccaacgcggccagcctg
ctgccggtgcacgcaatgcagatcaagtatttggtggctgagcgcggggtcaaccgcgaa
ttggaagcgctgccgtcggagaaggagattgcccggcgctccgaggccggcatcgggctc
acctcgcccgaactcgccacgctgatggcgcacgtcaagctggggctcaaagaggaggtg
ctagccaccgaactaccggatcaggatgtcttcgcttccaggttgcctcgttatttcccg
acggcgctgcgcgaacggttcaccccggagatccgttcccaccagctgcgccgcgagatc
gtcaccaccatgctgatcaacgatctggtggataccgccggcatcacctatgcgttccgg
atcgccgaagacgttggtgtcacgccgatcgatgccgtgcgcacctatgtcgccaccgat
gccatcttcggtgtcggtcacatttggcgccggatccgtgcggcgaacctgccaatcgcg
ctgtcagacaggttgacgctggacacccgtcggctgatcgaccgtgccggacgctggctg
ctcaactaccgtccgcagcccttggccgtcggcgccgagatcaaccgattcgcggccatg
gtcaaggcactgacaccgcgcatgtcggagtggttgcgtggtgatgacaaggccatcgtc
gaaaagacagctgcggaattcgcatcgcagggtgtgcctgaagacttggcctaccgtgtc
tcgaccggcctgtaccggtacagcctgctcgacatcatcgacatcgccgacatcgccgac
atcgacgccgccgaggtcgctgacacctatttcgccctgatggaccggctgggcaccgat
ggcctgctgaccgcggtatcccagctgccccgacacgaccgctggcattcgttggcgcgc
ttggcgattcgcgacgatatttacggtgcgctacggtcgttgtgtttcgacgtgctggcc
gtgggggaacccggcgagagtagcgagcaaaagatcgccgagtgggaacacctcagcgcc
tcccgggtggcgcgggcacgtcggacactcgacgacatccgtgccagcggccagaaggat
ctggcgacgttgtcggtcgccgcgcggcagatccgccgcatgacacggacaagcgggcga
ggaatctcggggtga

DBGET integrated database retrieval system