KEGG   Mycobacterium tuberculosis H37Rv: Rv2483cHelp
Entry
Rv2483c           CDS       T00015                                 

Gene name
plsC
Definition
(RefSeq) bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase
  KO
K15781  
putative phosphoserine phosphatase / 1-acylglycerol-3-phosphate O-acyltransferase [EC:3.1.3.3 2.3.1.51]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     Rv2483c (plsC)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     Rv2483c (plsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
TubercuList: 
UniProt: 
Position
complement(2789280..2791022)
Genome map
AA seq 580 aa AA seqDB search
MSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVAGFTAVILTQE
RLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAALAGRLLTDLEEIGERLFAQRI
ESRIYPEMRELVRAHVARGHTVVLSSSALTIQVGPVARFLGINNMLTNKFETNEDGILTG
GVLKPILWCPGKATAVQRFAAEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAA
VAKRRGWPILKFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTST
FSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNWVGVGKKELAS
DPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLSIVIAPEGTRLDTTEVGSFKK
GPFRIAMAAKIPIVPIVIRNAEIVASRNSTTINPGTVDVAVFPPIPVDDWTLDALPDRIA
EVRQLYLDTLADWPVDGLPAVDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGA
AATKAATKKASPKAKPSESKIAGKDGEASASPSSSAKGRS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctgacgagcagggggaagagcgggcgacgcggaagtcggcgccggatttg
cgcctacccggttcggtagccgagattctggccagtcctgccggcccgaaggtcggtgcg
tttttcgacctggacggcacgctggtcgccggcttcacggccgtcatcctcacccaggag
aggctgcggcgccgcgatatgggcgtgggcgagctgctcggtatggttcaggccggcctg
aatcacacgctcgggcgaatcgagttcgaagaccttatcggaaaggccgccgcggcgctg
gccgggcggctcttgaccgacctggaagaaatcggcgagcggctattcgcccagcggatc
gagtcccggatctacccggaaatgcgggaactggtccgggctcacgtggcccgcggccac
accgtggtcctcagctcgtcggcgctgaccatccaagttggcccagtcgcacgttttctg
gggatcaacaacatgctcaccaacaagttcgagaccaacgaggacgggatactcaccggg
ggtgtgctgaagccaattttgtggtgtccgggcaaagccactgcggtgcaacgctttgcg
gccgagcacgacatcgatctcaaagacagttacttctatgccgacggtgacgaggacgtc
gccctgatgtatctggtgggcaatccgcgaccgaccaatccggaaggaaagatggccgcg
gtcgccaagcgacggggctggccgatcttgaagttcaacagtcgcggcggtgtgggcatc
cggcggcagttgcggacacttgccggtctgagcaccatcgtcccggtcgcggccggcgcg
gtagggatcggtgtgctgaccggtagccggcgccgcggcgtgaatttctttacctccacc
ttctctcagctgctgctggcgaccagcggcgtgcacctgaatgtgatcggaaaagagaat
ctgaccgcccagcggcccgccgtctttatcttcaaccaccgcaaccaggttgacccggtc
attgccggtgcgctggtgcgcgacaactgggttggggtgggcaagaaggaactggcgagc
gacccgatcatgggcacgctggggaagttgctggacggtgtgttcatcgaccgtgatgat
ccggtcgccgcggtggagacactgcacacggttgaggagcgcgcccgcaatggactatcg
atcgtgatcgctcccgaaggtacccggttggataccaccgaagtcgggtcattcaagaag
gggcccttccgtatcgccatggccgcgaagatcccgatcgtgccgatcgtgatccgcaat
gcggagatcgtcgcctcgcgcaactccaccacgatcaatccgggcacggtcgacgtcgcg
gtgtttccgccgattccggtcgatgactggaccctggacgccctgccggatcgtatcgcc
gaggtgcgccagctgtatctggacacgctggcggactggccggtcgatgggttgcccgcg
gtcgatctgtacgccgagcagaaggccgccagaaaagccagggctcaggtcgccaaggcc
accgcgaaaagggtgccggctaagaaggctcccgccaaaagcgccgccaataaaggcgcg
gccgcgacgaaggcggctacaaagaaggcatcgccgaaggccaaacccagcgaatctaag
atcgctggcaaggatggtgaggcctccgcatcgccaagctctagcgccaaaggacggtcg
tga

DBGET integrated database retrieval system